KEGG   Sulfolobus solfataricus P2: SSO0445Help
Entry
SSO0445           CDS       T00054                                 

Gene name
speB-1
Definition
agmatinase SpeB (EC:3.5.3.11)
Orthology
K01480  
agmatinase [EC:3.5.3.11]
Organism
sso  Sulfolobus solfataricus P2
Pathway
Arginine and proline metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sso00001]
 Metabolism
  Amino acid metabolism
   00330 Arginine and proline metabolism
    SSO0445 (speB-1)
Enzymes [BR:sso01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.11  agmatinase
     SSO0445 (speB-1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
384378..385271
Genome map
AA seq 297 aa AA seqDB search
MSDGRLLYLNENSRKFAGFNKEKSPFVIIGIPMDITSSYRPGSRFAPSSIRESAQYIEFY
SIRNDVDMGEIGFNDVGDIILHPSNVEENLSRISSVISYFQESGKITISIGGEHTITAGI
IKGTKREGLCLVSFDAHLDLRDEYMGYRYDHACVMRRISEYGVKIIEVGTRAVSKEEIEY
AKQKGILFFTPQQIRLLGVKETARRIITSTQECKSLYISVDMDGIDPAYAPGVATPEPDG
LDPTNLLDIINLIADKRVIGFDIVEVSPSYDTSGITSVLASRIILETAATVYKARSL
NT seq 894 nt NT seq  +upstreamnt  +downstreamnt
gtgagcgatggaagattactttatttaaatgagaatagtaggaaatttgctggatttaac
aaggaaaaatccccatttgtaataattggaatacctatggacattacgagtagttatagg
cctggaagtagatttgctccgtcttcaattagagaatcggctcaatatattgaattttat
tcaatacgaaatgatgtagatatgggggaaataggtttcaatgatgtaggtgatataatt
ctacatccttcaaacgttgaggagaatttaagtagaatatccagtgtgattagttatttc
caagaaagtgggaagatcactatttctataggaggagagcatacaataaccgcgggaata
ataaaggggactaagagagaaggattatgcctagttagcttcgatgcacatttagattta
agagacgagtatatgggatatagatatgatcacgcttgtgttatgaggagaatatctgaa
tatggtgtgaaaattattgaagtcggtactagggcagttagtaaagaggaaatagaatat
gctaaacaaaagggtatactcttcttcacccctcagcaaattagacttttaggagtcaag
gaaactgcaagaagaataattacctcaacgcaagaatgtaaatcgctctatatctcagtt
gatatggatgggatagatccagcttatgcacccggcgtagcaacaccagaaccagatgga
ttagaccccactaacctgttagatattattaacttaattgcagataaaagagttataggg
tttgatattgtggaagtttctccttcttatgacacctcaggaataactagtgtattggct
tccagaataattctggagacagcagctacagtttataaagctagatcgctttaa

DBGET integrated database retrieval system