KEGG   Sulfolobus solfataricus P2: SSO0445Help
Entry
SSO0445           CDS       T00054                                 

Gene name
speB-1
Definition
agmatinase SpeB (EC:3.5.3.11)
Orthology
K01480  
agmatinase [EC:3.5.3.11]
Organism
sso  Sulfolobus solfataricus P2
Pathway
Arginine and proline metabolism
Metabolic pathways
Class
Metabolism; Amino acid metabolism; Arginine and proline metabolism [PATH:sso00330]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
384378..385271
Genome map
AA seq 297 aa AA seqDB search
MSDGRLLYLNENSRKFAGFNKEKSPFVIIGIPMDITSSYRPGSRFAPSSIRESAQYIEFY
SIRNDVDMGEIGFNDVGDIILHPSNVEENLSRISSVISYFQESGKITISIGGEHTITAGI
IKGTKREGLCLVSFDAHLDLRDEYMGYRYDHACVMRRISEYGVKIIEVGTRAVSKEEIEY
AKQKGILFFTPQQIRLLGVKETARRIITSTQECKSLYISVDMDGIDPAYAPGVATPEPDG
LDPTNLLDIINLIADKRVIGFDIVEVSPSYDTSGITSVLASRIILETAATVYKARSL
NT seq 894 nt NT seq  +upstreamnt  +downstreamnt
gtgagcgatggaagattactttatttaaatgagaatagtaggaaatttgctggatttaac
aaggaaaaatccccatttgtaataattggaatacctatggacattacgagtagttatagg
cctggaagtagatttgctccgtcttcaattagagaatcggctcaatatattgaattttat
tcaatacgaaatgatgtagatatgggggaaataggtttcaatgatgtaggtgatataatt
ctacatccttcaaacgttgaggagaatttaagtagaatatccagtgtgattagttatttc
caagaaagtgggaagatcactatttctataggaggagagcatacaataaccgcgggaata
ataaaggggactaagagagaaggattatgcctagttagcttcgatgcacatttagattta
agagacgagtatatgggatatagatatgatcacgcttgtgttatgaggagaatatctgaa
tatggtgtgaaaattattgaagtcggtactagggcagttagtaaagaggaaatagaatat
gctaaacaaaagggtatactcttcttcacccctcagcaaattagacttttaggagtcaag
gaaactgcaagaagaataattacctcaacgcaagaatgtaaatcgctctatatctcagtt
gatatggatgggatagatccagcttatgcacccggcgtagcaacaccagaaccagatgga
ttagaccccactaacctgttagatattattaacttaattgcagataaaagagttataggg
tttgatattgtggaagtttctccttcttatgacacctcaggaataactagtgtattggct
tccagaataattctggagacagcagctacagtttataaagctagatcgctttaa

DBGET integrated database retrieval system