KEGG   Sulfolobus solfataricus P2: SSO0480Help
Entry
SSO0480           CDS       T00054                                 

Definition
histone acethyltransferase
Orthology
K07739  
elongator complex protein 3 [EC:2.3.1.48]
Organism
sso  Sulfolobus solfataricus P2
Brite
Enzymes [BR:sso01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     SSO0480
Transfer RNA biogenesis [BR:sso03016]
 Eukaryotic Type
  tRNA modification factors
   Elongator complex
    SSO0480
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(413903..415324)
Genome map
AA seq 473 aa AA seqDB search
MQVIRKPTRMLSGVTIVSIMTHPHSCPHGKCVFCPGGVDVDTPQSYYGREPTLMRAIEND
YDPFHQVQSRLRQYVENGHTPSKVELIIMGGTFLSLPIDYQDWFVTYALEAMNRFPSYDK
PSFVYLEDAQVKNEKAEVRCVGMTIETKPDWAKEWHADQMLRLGATKVELGVQTVYDDIL
KFTNRGHTVKDSIESTRILKDSGFKVVYHVMLGLPKSDPDKDLEAFKTIFSDPNFRPDML
KIYPTLVVETAPLANLWRRGLYKPYGTETLIELISEMYRYIPKWVRVMRIQRDIPANVIL
DGNKKGNLRELVEKKVLEKGIKINEIRFREVGMMWQHRGLLPDHTKIHLYKEVYEASEGT
EIFLSFEDEKEILIGYLRLRITSNKAHRKEIDGKTAIVRELHVYGIEVPIGSWDELGFQH
RGYGSKLLSEAEKIAREEFDMRKISVLSGIGAREYYAKRGYVKEGPYMSKQLI
NT seq 1422 nt NT seq  +upstreamnt  +downstreamnt
atgcaagtaataaggaaaccaactagaatgctttctggcgttacgatagtatcgataatg
actcacccgcattcttgtccgcatggaaagtgtgtattctgtcccggaggagtagatgtg
gataccccccaaagctactatggtagagaacccactttaatgagggcaatagaaaacgat
tatgatccattccatcaagtacagtcaagattaagacaatatgttgagaatggacatact
ccaagtaaagtagagttaataataatgggtggtactttcctatcattacccatagattat
caagattggtttgtgacctatgccttagaggctatgaatagatttcctagttatgataaa
ccttcttttgtatatttagaagatgcacaagtgaaaaacgaaaaggcagaagtacgttgt
gtaggaatgacgattgaaacgaaaccggattgggctaaggagtggcacgcagatcaaatg
ctaagattaggtgcaaccaaagttgaattaggagtgcaaactgtatacgatgacatttta
aagttcaccaataggggtcataccgtaaaagattccatagaatctactagaatactgaag
gattcagggttcaaagtggtctatcatgtaatgcttggtcttcctaaatcagatcctgat
aaggatctggaggcatttaagacaatattttctgatcctaattttaggccggatatgttg
aaaatatatcctaccttagtagttgaaactgcgccgttagcgaatttatggagaagggga
ttatataagccttatggtacggagactttaattgaattaatatctgaaatgtatagatat
attcctaaatgggttagagtgatgagaatacaaagagatattcctgctaatgtaatctta
gatggtaacaaaaagggaaacttaagagaattggtagagaaaaaggtcttggagaaagga
attaagattaatgaaattagatttagggaagttgggatgatgtggcaacataggggatta
ttaccagatcatactaaaattcatctttacaaggaagtttatgaagcaagtgaaggtact
gaaattttcctatcttttgaggatgaaaaagagattttaataggttatttacgattaaga
ataacatcaaataaggctcatagaaaagagatagatggaaagacggccatagtaagagaa
cttcacgtatacgggatagaagtacctataggaagctgggatgaattgggtttccaacat
agggggtatggaagtaagttattaagcgaagctgaaaagattgcgagagaggaattcgat
atgcggaaaatttctgttttatctggaataggtgctcgagaatactatgctaaaagaggc
tatgtaaaagaaggtccttatatgtctaagcagttgatttga

DBGET integrated database retrieval system