KEGG   Sulfolobus solfataricus P2: SSO0493Help
Entry
SSO0493           CDS       T00054                                 

Gene name
thrC-1
Definition
threonine synthase (EC:4.2.3.1)
Orthology
K01733  
threonine synthase [EC:4.2.3.1]
Organism
sso  Sulfolobus solfataricus P2
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:sso00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    SSO0493 (thrC-1)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    SSO0493 (thrC-1)
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    SSO0493 (thrC-1)
Enzymes [BR:sso01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     SSO0493 (thrC-1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
424521..425558
Genome map
AA seq 345 aa AA seqDB search
MISSMVKEVCMKCRKERESIYEIKCNKCGGPFEILIDFEFDKNSERGFPYSEKIFPYIKH
FISLGEGRTPLIKKGNIWFKLDFLNPSGSYKDRGAVTLVSYLAEKGVKQISEDSSGNAGS
AIAAYSAAAGIEAYIFVPETAKGGKLKQIESYGAHVVRVRGSREDVAKAAENSGYYYASH
VLQPQFRDGIRTLAYEIVKDLDWKIPNYVFIPVSAGTLLLGVYKGFKHLLDSGVISEMPK
IVAVQTEQVMPLCAKFKKISYTPPDKVTSIADALVSTRPFLLDYMVKASSECIVVSDNEI
VEAWKELAKMGLLVEYSSATVFAAYKKYSVNDAVLVLTGSGLKVL
NT seq 1038 nt NT seq  +upstreamnt  +downstreamnt
gtgattagtagtatggtaaaagaggtttgtatgaaatgcagaaaggaaagggaaagtata
tacgagattaagtgtaacaaatgcggaggaccattcgagatcctgatagattttgaattt
gataagaattctgagagaggttttccctatagtgaaaagattttcccttacatcaaacat
ttcatatccctaggagagggaagaactccattaattaaaaaggggaacatatggtttaaa
ctcgacttcttaaatccatcaggatcatacaaggatagaggagcagtgactctggtctct
tatcttgcggaaaaaggtgtaaaacaaattagtgaagactcttctggaaatgcaggatca
gcaatagctgcgtattctgcagctgctggtattgaggcatacattttcgttcctgaaacg
gcaaaaggaggaaaacttaagcaaatagaatcctacggtgctcacgttgttagagtaagg
gggagtagagaagatgtagcaaaagctgcagagaattctggttactattacgcatcacat
gttttacaacctcaatttagagatgggattagaactctggcatatgaaattgtaaaggat
ttagattggaaaattcctaattatgttttcattccagtatcagcaggaactttactttta
ggtgtttataaggggttcaagcacttgctagattctggtgtcatatcggaaatgcctaaa
atcgtagcagtccaaacagagcaagttatgccactttgtgctaaattcaaaaagatttct
tacacaccaccagacaaggttacctccattgcagacgctttagtatcaactagaccattt
ctactagattatatggtaaaggcttctagtgaatgcatagttgtaagcgataatgaaata
gtagaagcttggaaagaattggctaaaatgggactgctggtagaatatagttctgctact
gtatttgctgcttataagaaatacagtgttaacgatgcagtattagttttaaccggtagc
ggattaaaggtattatga

DBGET integrated database retrieval system