KEGG   Sulfolobus solfataricus P2: SSO0493Help
Entry
SSO0493           CDS       T00054                                 

Gene name
thrC-1
Definition
(GenBank) Threonine synthase (thrC-1)
  KO
K01733  threonine synthase [EC:4.2.3.1]
Organism
sso  Sulfolobus solfataricus P2
Pathway
sso00260  Glycine, serine and threonine metabolism
sso00750  Vitamin B6 metabolism
sso01100  Metabolic pathways
sso01110  Biosynthesis of secondary metabolites
sso01120  Microbial metabolism in diverse environments
sso01230  Biosynthesis of amino acids
Module
sso_M00018  Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:sso00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    SSO0493 (thrC-1)
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    SSO0493 (thrC-1)
Enzymes [BR:sso01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     SSO0493 (thrC-1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PALP Zn-ribbon_8 DFP
Motif
Other DBs
NCBI-ProteinID: AAK40813
UniProt: Q97ZT5
Position
424521..425558
Genome map
AA seq 345 aa AA seqDB search
MISSMVKEVCMKCRKERESIYEIKCNKCGGPFEILIDFEFDKNSERGFPYSEKIFPYIKH
FISLGEGRTPLIKKGNIWFKLDFLNPSGSYKDRGAVTLVSYLAEKGVKQISEDSSGNAGS
AIAAYSAAAGIEAYIFVPETAKGGKLKQIESYGAHVVRVRGSREDVAKAAENSGYYYASH
VLQPQFRDGIRTLAYEIVKDLDWKIPNYVFIPVSAGTLLLGVYKGFKHLLDSGVISEMPK
IVAVQTEQVMPLCAKFKKISYTPPDKVTSIADALVSTRPFLLDYMVKASSECIVVSDNEI
VEAWKELAKMGLLVEYSSATVFAAYKKYSVNDAVLVLTGSGLKVL
NT seq 1038 nt NT seq  +upstreamnt  +downstreamnt
gtgattagtagtatggtaaaagaggtttgtatgaaatgcagaaaggaaagggaaagtata
tacgagattaagtgtaacaaatgcggaggaccattcgagatcctgatagattttgaattt
gataagaattctgagagaggttttccctatagtgaaaagattttcccttacatcaaacat
ttcatatccctaggagagggaagaactccattaattaaaaaggggaacatatggtttaaa
ctcgacttcttaaatccatcaggatcatacaaggatagaggagcagtgactctggtctct
tatcttgcggaaaaaggtgtaaaacaaattagtgaagactcttctggaaatgcaggatca
gcaatagctgcgtattctgcagctgctggtattgaggcatacattttcgttcctgaaacg
gcaaaaggaggaaaacttaagcaaatagaatcctacggtgctcacgttgttagagtaagg
gggagtagagaagatgtagcaaaagctgcagagaattctggttactattacgcatcacat
gttttacaacctcaatttagagatgggattagaactctggcatatgaaattgtaaaggat
ttagattggaaaattcctaattatgttttcattccagtatcagcaggaactttactttta
ggtgtttataaggggttcaagcacttgctagattctggtgtcatatcggaaatgcctaaa
atcgtagcagtccaaacagagcaagttatgccactttgtgctaaattcaaaaagatttct
tacacaccaccagacaaggttacctccattgcagacgctttagtatcaactagaccattt
ctactagattatatggtaaaggcttctagtgaatgcatagttgtaagcgataatgaaata
gtagaagcttggaaagaattggctaaaatgggactgctggtagaatatagttctgctact
gtatttgctgcttataagaaatacagtgttaacgatgcagtattagttttaaccggtagc
ggattaaaggtattatga

DBGET integrated database retrieval system