KEGG   Sulfolobus solfataricus P2: SSO0813Help
Entry
SSO0813           CDS       T00054                                 

Definition
UTP-glucose-1-phosphate uridylyltransferase (EC:2.7.7.9)
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
sso  Sulfolobus solfataricus P2
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:sso00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    SSO0813
   00052 Galactose metabolism
    SSO0813
   00500 Starch and sucrose metabolism
    SSO0813
   00520 Amino sugar and nucleotide sugar metabolism
    SSO0813
Enzymes [BR:sso01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     SSO0813
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
697868..698608
Genome map
AA seq 246 aa AA seqDB search
MGTRLLPASKEIPKEMFPIPFNGQFKPIIQIIFEQLYDIGIRDFVIVVGRGKRVIEDHFT
PDYDFINYLEAKGKVIQANYLRQFYQKVENSRIAFVNQPEPKGFGDAVLRAEPFIQGEFL
VVAADTILPMIPISSMVVNSFLVTTVQDPRPYGVVLVDKQGCVIDIEEKPKQPKSNLVVV
PYYMFDEEIFDELRQIKYEEELQLTDGIKGLIKRGRRFKAIMVDKVYDLGTVENYIESLR
RLLNND
NT seq 741 nt NT seq  +upstreamnt  +downstreamnt
ttgggcactagattacttccagcatctaaagaaattcctaaggaaatgtttcctatccct
tttaatgggcaatttaaacctataattcagattattttcgaacagttatatgacatcgga
ataagggacttcgttattgtagtcggaagagggaagagagttattgaggatcacttcaca
ccagactatgactttattaattacctcgaagctaagggcaaggttatccaagcaaattat
ttaaggcaattttaccagaaagttgagaatagtagaatagcttttgttaatcaaccagaa
cctaaaggtttcggcgatgcggtgctaagggcagaaccttttattcaaggagaatttcta
gtagtggccgcggacacaattctacccatgatacctatatcatcaatggttgttaactca
tttttagttactactgtccaagacccaagaccttacggtgtcgttttagtagataagcag
gggtgtgtgatagatatagaggagaagccgaagcagcctaagtctaacttggtcgtagtt
ccttattacatgtttgatgaagagatattcgatgaattaagacaaataaaatacgaagag
gaattgcaattgacagatggtattaaaggtcttataaaaaggggtagaagattcaaggct
ataatggttgataaagtttacgacttaggcactgtcgagaattatatagaatccttaaga
agattactaaacaacgattag

DBGET integrated database retrieval system