KEGG   Sulfolobus solfataricus P2: SSO0878Help
Entry
SSO0878           CDS       T00054                                 

Gene name
thrC-2
Definition
(GenBank) Threonine synthase (thrC-2)
  KO
K01733  threonine synthase [EC:4.2.3.1]
Organism
sso  Sulfolobus solfataricus P2
Pathway
sso00260  Glycine, serine and threonine metabolism
sso00750  Vitamin B6 metabolism
sso01100  Metabolic pathways
sso01110  Biosynthesis of secondary metabolites
sso01120  Microbial metabolism in diverse environments
sso01230  Biosynthesis of amino acids
Module
sso_M00018  Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:sso00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    SSO0878 (thrC-2)
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    SSO0878 (thrC-2)
Enzymes [BR:sso01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     SSO0878 (thrC-2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PALP Zn-ribbon_8 TF_Zn_Ribbon HypA zinc_ribbon_2 Mu-like_Com
Motif
Other DBs
NCBI-ProteinID: AAK41164
UniProt: Q97ZL6
Position
complement(748150..749340)
Genome map
AA seq 396 aa AA seqDB search
MKCLNCGYETEIDQSQILCPRCGGLLEIILEPPKDFSFSKLRGRGVWRYKELIAGRYKNI
VSINEGNTPLIRSSNINDNLYFKFEGLNPTGSFKDRGMTVAVSSAVSLNYKTVIAASTGN
TAASAAAYAARAGIKSFIVLPKGKVALGKLAQSILYGSVILEVDGSFDVAMDAVMRLYKD
LKVVYPLNSFNPWRLEGQKTIAFEIAEELGVPDNVIVPVGNAGNIYAIWKGFNELVKTGV
INTIPRMIGIQAEGASPIVTAIIKGKDSPDFIENPDTVATAIRIGKPVNWQKAMKAIRES
NGTAIAVSDSEILDAQKTLARKEGIGAEPASAAALAGYIKAINEKVVDKDEKTVLILTGH
SLKDPDSMTKAEAKRILVNPLHMEKIILGEINGSNS
NT seq 1191 nt NT seq  +upstreamnt  +downstreamnt
atgaagtgcttgaattgtggatatgaaacggaaatagatcaaagtcagatattatgtcca
agatgtggaggactattagaaattatactagaaccaccaaaggacttctctttcagtaaa
ttgagaggaagaggagtttggagatataaagaattaatagcaggcagatacaaaaatatt
gtaagcataaatgagggaaataccccactaattagatcctcaaatataaatgataatctt
tattttaaatttgaagggcttaatccaactggtagttttaaggatagaggaatgacagtg
gcagttagttctgcggtaagcttgaattacaaaactgtaatagccgcatccactggaaat
actgcagcttctgcagctgcttatgctgcaagagctggtataaagagctttatcgtctta
cctaaaggtaaggtagcattaggtaaattagctcaatcaatactttatggctcagttatt
ttagaagttgatggaagttttgacgttgctatggatgcagtaatgagattatataaggat
ttaaaagtagtatatccattaaattcctttaatccatggagattagaaggacaaaagaca
atcgcatttgagatagcagaagaactaggagttcctgacaacgtgatagtcccggtaggc
aatgcaggcaatatctacgccatatggaaaggatttaatgagctagttaaaactggagtt
attaatactattcctagaatgattggaatccaagctgagggcgcatcaccaatagttacc
gcaataataaaaggaaaagattctccagatttcatagaaaatccagatactgtagcaaca
gcaataaggatagggaaaccagttaattggcaaaaagcgatgaaagcaataagggaatct
aatggaaccgcaatagctgtatctgattccgagatattagacgcacagaagaccctagct
agaaaagagggcataggagctgagcctgcttcagcagctgccttagctggttatattaag
gcaataaatgaaaaggtggtagataaagatgaaaaaacagttttaatcctaacaggacat
tcgttaaaggatcccgatagtatgacaaaagctgaggctaaaagaatattagttaatcct
ttacatatggaaaaaattatcctaggtgagataaatggctctaatagttaa

DBGET integrated database retrieval system