KEGG   Sulfolobus solfataricus P2: SSO0888Help
Entry
SSO0888           CDS       T00054                                 

Gene name
trpB
Definition
(GenBank) Tryptophan synthase beta chain (trpB) (EC:4.2.1.20)
  KO
K06001  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
sso  Sulfolobus solfataricus P2
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:sso00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    SSO0888 (trpB)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    SSO0888 (trpB)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    SSO0888 (trpB)
Enzymes [BR:sso01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     SSO0888 (trpB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
756108..757385
Genome map
AA seq 425 aa AA seqDB search
MVKEDEILPKYWYNIIPDLPKPLPPPRDPQGAYFSRIDLLRSILPKEVLRQQFTIERYIK
IPEEVRDRYLSIGRPTPLFRAKRLEEYLKTPARIYFKYEGATPTGSHKINTAIPQAYFAK
EEGIEHVVTETGAGQWGTAVALAASMYNMKSTIFMVKVSYEQKPMRRSIMQLYGANVYAS
PTNLTEYGRKILETNPQHPGSLGIAMSEAIEYALKNEFRYLVGSVLDVVLLHQSVIGQET
ITQLDLLGEDADILIGCVGGGSNFGGFTYPFIGNKKGKRYIAVSSAEIPKFSKGEYKYDF
PDSAGLLPLVKMITLGKDYVPPPIYAGGLRYHGVAPTLSLLTKEGIVEWREYNEREIFEA
AKIFIENQGIVPAPESAHAIRAVVDEAIEARKNNERKVIVFNLSGHGLLDLSNYESMMKR
LNGNG
NT seq 1278 nt NT seq  +upstreamnt  +downstreamnt
atggtaaaagaagacgagattttgcctaaatattggtacaatataatccctgatctacct
aaacccttgcctccaccaagggatccacaaggtgcctatttctcgagaatcgatttatta
agaagtatactacccaaggaggtattaagacaacaattcacaatagaaaggtatataaag
atccctgaggaagtaagagatagatatttatcgataggaagaccaactccattatttagg
gctaaaaggttagaagagtacttaaagacaccagcaagaatttactttaaatatgaaggt
gctacacctactggatctcataagataaatacagcaattcctcaagcgtattttgcaaaa
gaagagggaattgaacacgtagttactgaaactggagctggtcaatggggaactgcagtc
gcacttgcagctagtatgtataatatgaaaagtactatattcatggtaaaggtaagttat
gaacaaaaaccgatgagaaggagtataatgcaattatatggggctaatgtttacgcaagc
cccacaaacttaactgaatacggtaggaagatattagagacaaacccacagcatccagga
tcattaggtatagcaatgagcgaggcaatagagtatgctcttaagaacgaatttagatat
ttagtaggtagcgttttagatgtagtacttttgcatcagagtgttattggtcaagagact
attactcaattggatttgttaggagaagacgctgatatcctaattggatgtgtaggaggt
gggagcaattttggcggtttcacatacccctttatcggaaataagaaaggcaagcgttat
attgcagtaagttctgcagaaattccaaagtttagtaaaggtgaatataaatacgatttt
ccagactctgctggattattacctttagtgaaaatgataactttaggtaaagattacgtt
ccgccaccaatatacgcaggcgggttaagatatcatggtgtagcaccaacattaagtttg
ttaacaaaggagggtattgtggaatggagagaatacaatgaaagggagattttcgaagct
gctaagatatttatcgagaaccaaggtattgtaccagccccagaatcagctcatgcaata
agggcagtagttgatgaagctatagaggcaagaaagaataatgagcgaaaggtcatcgtc
tttaatctaagtggacatggattgttagatctgtcaaattacgaatccatgatgaaaagg
ttgaatggaaatgggtaa

DBGET integrated database retrieval system