KEGG   Sulfolobus solfataricus P2: SSO0889Help
Entry
SSO0889           CDS       T00054                                 

Gene name
trpA
Definition
(GenBank) Tryptophan synthase alpha chain (trpA) (EC:4.2.1.20)
  KO
K01695  
tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
sso  Sulfolobus solfataricus P2
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:sso00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    SSO0889 (trpA)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    SSO0889 (trpA)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    SSO0889 (trpA)
Enzymes [BR:sso01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     SSO0889 (trpA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
757372..758109
Genome map
AA seq 245 aa AA seqDB search
MEMGKMLVVYMTLGYPNVQSFKDFIIGAVENGADILELGIPPKYAKYDGPVIRKSYDKVK
GLDIWPLIEDIRKDVGVPIIALTYLEDWVDQLENFLNMIKDVKLDGILFPDLLIDYIDDL
DKIDGIIKNKGLKNVIFTSPSVPDLLIHKVSKISDLFLYYGVRPTTGVPIPVSVKQLINR
VRNLVENKLIVGFGLSSESDLRDALSAGADGIAIGTVFIEEIERNGVKSAINLVKKFRAI
LDEYK
NT seq 738 nt NT seq  +upstreamnt  +downstreamnt
atggaaatgggtaagatgcttgtagtctatatgacgttaggttatccaaatgttcaaagt
tttaaggattttattattggggcagttgaaaatggagctgatatattagagcttggaatc
ccccctaagtatgctaagtatgatggtccagttataaggaagagttatgataaagtaaaa
gggctagatatttggcccttaatagaagatattaggaaagatgtgggtgttcccataatt
gcacttacttatttagaagattgggttgatcagctagagaattttctaaatatgataaaa
gacgtcaaactggacggaattctatttccagatttacttattgattatatagatgatttg
gataaaattgatgggataataaaaaataaaggattaaaaaacgttatttttacatctcct
tcagtaccagatcttctaatccacaaagtctctaagattagcgatttattcttatattat
ggtgtcagaccaactactggcgtacctataccagtatcagttaagcaattgattaataga
gttagaaatctagttgagaataagctaatagtaggatttggcttatcaagcgagtcagat
ttaagagatgctctaagtgctggtgctgacggaatagcaattggaactgtgttcatagag
gaaattgagaggaatggtgtaaaatctgcaataaatttagttaaaaaatttagggcgata
ttagatgaatataaatga

DBGET integrated database retrieval system