KEGG   Sulfolobus solfataricus P2: SSO1207Help
Entry
SSO1207           CDS       T00054                                 

Gene name
porA-1
Definition
pyruvate synthase subunit alpha (EC:1.2.7.1)
Orthology
K00169  
pyruvate ferredoxin oxidoreductase, alpha subunit [EC:1.2.7.1]
Organism
sso  Sulfolobus solfataricus P2
Pathway
Glycolysis / Gluconeogenesis
Citrate cycle (TCA cycle)
Pyruvate metabolism
Nitrotoluene degradation
Propanoate metabolism
Butanoate metabolism
Methane metabolism
Carbon fixation pathways in prokaryotes
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
Pyruvate oxidation, pyruvate => acetyl-CoA
Dicarboxylate-hydroxybutyrate cycle
Brite
KEGG Orthology (KO) [BR:sso00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    SSO1207 (porA-1)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SSO1207 (porA-1)
   00020 Citrate cycle (TCA cycle)
    SSO1207 (porA-1)
   00620 Pyruvate metabolism
    SSO1207 (porA-1)
   00640 Propanoate metabolism
    SSO1207 (porA-1)
   00650 Butanoate metabolism
    SSO1207 (porA-1)
  Energy metabolism
   00720 Carbon fixation pathways in prokaryotes
    SSO1207 (porA-1)
   00680 Methane metabolism
    SSO1207 (porA-1)
  Xenobiotics biodegradation and metabolism
   00633 Nitrotoluene degradation
    SSO1207 (porA-1)
Enzymes [BR:sso01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.1  pyruvate synthase
     SSO1207 (porA-1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1045601..1046758)
Genome map
AA seq 385 aa AA seqDB search
MQVLKRKVLALVGNHAVAYAVKQAKPKVLAVFPITPQTTMLEKLSEYISSEELKAELIKV
ESEHSALASIYGAALAGARVFTATSSQGLLYMTEMIYWAGGQRVPIVAAVATRAIAEPWS
IWDDHQDFVSKRDAIWIQIMAENVQEAYDMTIQAFRISEDERVILPVMMGFDGFILTHTM
ERIEVLEDNEVDNFLPPRQFNLIDFSDPIAIGPIATPEEYIKYRYEAMKAMERAKGVIEE
IMGEYERISGRKQHGLVECYKCEDAKYVFVTMGAWSGDGKAAVDRLRDSGVKTGLLKIRV
FRPFPKEKVEEYLRSMKGVVVFDRAYSYGYGGILVNEIKAALYGYRVPVYSVVAGIGGKD
VRPRHFQKVIEDLINDNLEEERWLF
NT seq 1158 nt NT seq  +upstreamnt  +downstreamnt
atgcaagttttaaagaggaaagttctagctttagtcggtaatcacgcagttgcttatgct
gttaagcaagctaaacccaaagttttagcagtattcccaataactcctcaaactacaatg
ttggagaaactttctgagtatatttcttcggaggaattaaaggctgagttaataaaggtt
gaaagcgaacattcagcattagcttcaatttatggtgcagcattagctggtgctagagtt
ttcactgctacttcttctcaaggacttctatacatgactgaaatgatatattgggccgga
ggtcaaagagttcctattgttgctgcagttgcaactagagctatagctgagccatggagt
atttgggatgatcatcaagatttcgtaagtaaaagagacgccatatggattcaaataatg
gcagaaaacgtgcaagaagcttacgatatgacaatacaagcttttagaatttcagaagat
gagagggtaatcttaccagtcatgatgggatttgacggcttcatattaactcatacaatg
gaaagaattgaggtattggaggataatgaggtagataattttttaccgcctaggcaattt
aatctaattgacttttccgaccctattgctattggaccaattgctactccagaggaatat
atcaagtatagatacgaggctatgaaagccatggagagagcaaaaggagttattgaagaa
ataatgggtgagtacgaaagaataagtggtaggaagcagcatggtttagttgagtgttat
aaatgtgaagatgctaaatacgttttcgttaccatgggtgcttggagtggtgacggtaaa
gctgcggttgatagattaagggatagtggagttaagactgggttgcttaaaatcagagtg
tttagaccatttccaaaggagaaagttgaggagtatttaaggtcaatgaaaggtgtagtg
gttttcgatagagcttactcatatggttatggtggcatcttagtgaatgagataaaggct
gcactttatgggtatagagtaccagtttatagtgtagtagcgggtattggtgggaaggac
gtcagaccacgtcatttccaaaaggtaattgaagacctaattaacgataatttagaagaa
gagaggtggctgttttga

DBGET integrated database retrieval system