KEGG   Sulfolobus solfataricus P2: SSO1333Help
Entry
SSO1333           CDS       T00054                                 

Gene name
aceA_icl
Definition
isocitrate lyase (EC:4.1.3.1)
Orthology
K01637  
isocitrate lyase [EC:4.1.3.1]
Organism
sso  Sulfolobus solfataricus P2
Pathway
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glyoxylate cycle
Class
Metabolism; Overview; Carbon metabolism [PATH:sso01200]
Metabolism; Carbohydrate metabolism; Glyoxylate and dicarboxylate metabolism [PATH:sso00630]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1168340..1169653)
Genome map
AA seq 437 aa AA seqDB search
MNIRDKWIEEEKSLEYEWSEDPRWRGIKRNYKPLDVVKLRGSIRIEYSLAKLASHKLWNL
LNTEPYVATFGALTGSQAVEMAKAGLKAIYVSGWQVAADNNLSNQTYPDLSLYPSNSVPN
LVKRLNNALIRADQISWSEGKHDIDYLLPIVADAEAGFGGPIHAFELTKALIEAGAAGVH
FEDQLAAEKKCGHLGGKVLIPISAFIRVLNAARLASDVLGVPTILIARTDALNAKYLSND
VDETDNQFLTGKRTSEGYYEIKGGIEYAIARGLAYAPYADLLWFETSKPDLEEARQFAEA
IHTHYPGKMLAYNLSPSFNWKKFMDDSKISKFMNELGEMGYKFQFITLAGWHLINYHTFK
LARAYRNEGMPAYVRLQELEFQAQAEGYTAVSHQREVGTDYFDLVLTIASGGEASTTAME
GSTEAEQFVEAKQKVLK
NT seq 1314 nt NT seq  +upstreamnt  +downstreamnt
atgaacatccgagataaatggattgaagaggagaaaagtctcgaatatgagtggtctgaa
gatccaaggtggagaggaataaagagaaattataagcccttggatgtggttaaattaaga
ggatctattagaattgagtatagtttagctaagttagcctctcacaaactttggaactta
ctaaatactgagccctatgtggcaacatttggggcattaacgggttcccaagcagtggaa
atggcaaaggcgggccttaaggctatttacgtaagtggatggcaagtagctgcagataac
aacttatcaaatcaaacttatccagacttaagcttatacccatctaacagcgttccaaac
ctagtaaagaggttaaataacgcccttataagggctgatcaaatatcttggagtgagggt
aaacatgatattgactatttactgcctattgttgcagatgctgaagctggttttggtggt
ccaattcacgccttcgaattaacaaaagccttaatagaggcaggggctgcaggggtacat
ttcgaagatcaattagcagcagagaagaagtgtggccatttaggagggaaagttctgatc
cctataagtgcatttataagagtactaaacgctgcaagactagcgtctgacgtattagga
gtaccaacaatactaatagcaaggacagacgcactgaatgctaaatacttatctaacgat
gtagatgagactgataatcaattcttaacaggaaagaggacatcagagggatattatgag
ataaagggtggtattgaatacgccatagctagaggattagcttatgcaccctatgctgac
ctattgtggtttgagacttctaagccagatttggaagaggctagacaatttgctgaggct
attcacactcattatccaggtaagatgttagcgtacaatttatccccctcatttaactgg
aagaaatttatggatgattctaaaattagcaagttcatgaacgaattgggagaaatgggc
tataaattccaattcattactcttgcaggttggcacttaattaactaccatacattcaaa
ttagcgagagcatatagaaatgaaggaatgccagcatatgtaagactacaagagttagag
ttccaagcacaagcagaaggctatactgcagtaagccaccagagagaggttggaacagat
tactttgacctagtgttaacaatagcgtctgggggagaagcgtccactactgcaatggaa
ggttccactgaagctgaacagtttgtagaggcaaaacagaaagtattaaaatag

DBGET integrated database retrieval system