KEGG   Sulfolobus solfataricus P2: SSO1334Help
Entry
SSO1334           CDS       T00054                                 

Gene name
aceB_mas
Definition
(RefSeq) malate synthase
  KO
K01638  
malate synthase [EC:2.3.3.9]
Organism
sso  Sulfolobus solfataricus P2
Pathway
Pyruvate metabolism
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:sso00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    SSO1334 (aceB_mas)
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    SSO1334 (aceB_mas)
   00630 Glyoxylate and dicarboxylate metabolism
    SSO1334 (aceB_mas)
Enzymes [BR:sso01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.9  malate synthase
     SSO1334 (aceB_mas)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1170115..1172595)
Genome map
AA seq 826 aa AA seqDB search
MSSSLKIPEEIYQKYSDLFGEKTINDRIVSVEKLIEELAVEFSDEIRKVINKRRLWLESK
DPVTSKGAFPSFDEVFVDADGNKRTFREIIQGMIDNFLGVQSKLKWRLNENVPIPKDAHP
LNNPGLEITGPWYPLSRAYNQINSDVACVMEDEEDASPAWYIPFGSGKTIADVWEGRKNV
KLFLSGKAPNPYYEKGKTYSLNKPRDKWPVIFHRLPGLHLLDFDITLNGKPVPAIIVSAV
IYTLNNYNSLKSAGSGVYFYLPKTQTPDEALIIEKILRRIESKLGLKIGTLKLALLYEEV
NAGRFFPVILWIFRERLIKSNNGRWDYLGSLIEMWLQEKVLPDPQNITMTSPNMMAYQKY
NALMMLLAGAKNGEADAAPVGGMAAVMLYPQTDPFGRNRYNLKALRGIKLDKLRERLIGL
IFVAEGKVEGKITLEDIVNGKVKGKLYDMFRQSWVATKEEAYVEAGSKPLRASLDELQKM
IDAPINYIEVEGTKLPTVDSGLTPEERALFQKLGLIDERGKITPWVITKEMINTPEKLLF
NKELWGGKDLWHSLYDIPEGDITPEHVQHAFYMAANYGFQLLNGNLAAAIDDYELKQRFM
NDLATYRIFTSWLWSVINRDASFTKDGYIKGPKLTKDGVIPAEDVLKVTKGTKVKDIFEK
LWELHLDWTYEFYKEQDMRASRRIAETFGKTNNASTVEEVYKVISKAYSSGPFREMSAKE
AAQKLAKILNANASEIEEELINLAPRFDRSMAPVIMEILMKEMLYPKYIMNSGKILFILS
PLDPERRSKVMDSIFSFRKMIEDKVKRGELDKWVLELYDYVYDNYW
NT seq 2481 nt NT seq  +upstreamnt  +downstreamnt
atgtcttctagccttaaaatccctgaggagatctatcaaaagtatagtgacctattcgga
gaaaagaccataaacgataggattgtaagtgttgaaaaactaattgaggagctcgcagtt
gagttctcagatgagataagaaaggttattaataaaaggcgactatggttagaatcaaaa
gaccccgtgacctcaaaaggtgcttttccatcctttgacgaagtctttgtagatgctgat
ggaaataagagaacctttagggaaatcattcaagggatgatagataacttcctcggggta
cagtcaaagctaaaatggaggttaaatgaaaatgtaccaataccaaaggacgcacatccc
ctcaataacccagggttagaaatcactggaccttggtatcctctgagtagggcgtataat
caaataaactcagacgtagcatgtgttatggaagatgaggaagacgcctcacctgcatgg
tatataccctttggttctggtaaaacaattgctgacgtatgggagggaagaaagaacgta
aaactcttcctctccggtaaggctccaaatccttattacgagaagggaaaaacgtacagc
ttaaacaaacctagggataagtggccagtgattttccacagactccctggattacacctc
ttggatttcgatataacgttaaatggtaaaccagtaccggctataattgtttctgccgtt
atatataccctaaacaattataatagtctgaagagtgcgggttctggagtatatttctat
ctacctaaaacccagacaccggatgaggcattgataatagaaaagatcttgagaagaatc
gagtctaaactaggacttaagataggtacacttaagctcgctctcctttatgaggaggtc
aatgctggaagatttttccctgtaatactgtggatatttcgtgagagactcataaaatca
aataacggtagatgggactatttgggaagtctgattgagatgtggttacaagagaaagta
cttccagatccccaaaacattaccatgacctcaccaaacatgatggcttatcaaaagtac
aacgcactcatgatgctattagctggggcgaagaacggcgaagccgatgctgctccagta
ggtggtatggcggcagtaatgctctaccctcaaactgacccattcgggagaaatagatac
aacttaaaggcattaaggggaataaagctagataagttaagggagaggctaataggactt
atctttgtggcagagggtaaagttgaaggtaaaatcactttagaggatatagttaacgga
aaagtaaagggtaaactttacgatatgttcagacagagttgggtagcgactaaggaagaa
gcttatgtagaggcagggagcaaacccttaagggcaagtttagatgagttacagaaaatg
attgacgcaccaattaattacattgaggtagagggaaccaaattacccaccgtggatagt
gggttaacaccagaagaaagagcgttattccaaaagcttggcctaattgatgaaagagga
aaaataacgccttgggttataaccaaggaaatgattaacactccagaaaagctattattt
aataaggaattatggggtggaaaagacctatggcattcgttatatgacatcccagaggga
gacattacaccagaacacgttcaacacgcgttttatatggcagcgaattacggtttccaa
ttgctaaatggcaacttagctgcggcaatagatgattatgaattaaagcaaaggttcatg
aacgacttagctacctatagaatattcacttcttggctatggagtgtaataaatagggat
gctagcttcacaaaggatggatatattaagggaccaaagctaactaaggatggtgtaatt
ccagctgaagacgttctaaaggtcacaaaggggacgaaggtaaaggatatattcgagaag
ttgtgggagttacacttagattggacatatgagttttacaaagaacaagatatgagagcg
tctaggagaatagctgaaacctttggaaagacaaataacgcttcaacggtggaagaggtg
tataaggtaatatctaaggcttatagttcaggtccgtttagggagatgtctgctaaagaa
gctgctcagaagctggcaaaaatccttaacgctaacgcttctgagatcgaggaagagctt
attaatttggccccgaggtttgacagatcaatggccccagtaattatggaaatattaatg
aaagagatgttatatcccaagtacataatgaatagcgggaagatactcttcatactctct
ccattggatccagagaggaggtcaaaggtaatggatagcatattctcgtttagaaaaatg
attgaagataaggtaaaaagaggagaactggataagtgggtattggagttatacgactac
gtttacgacaattactggtaa

DBGET integrated database retrieval system