KEGG   Sulfolobus solfataricus P2: SSO1340Help
Entry
SSO1340           CDS       T00054                                 

Gene name
acsA-2
Definition
hypothetical protein (EC:6.2.1.1)
Orthology
K01895  
acetyl-CoA synthetase [EC:6.2.1.1]
Organism
sso  Sulfolobus solfataricus P2
Pathway
Glycolysis / Gluconeogenesis
Pyruvate metabolism
Propanoate metabolism
Methane metabolism
Carbon fixation pathways in prokaryotes
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:sso00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    SSO1340 (acsA-2)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SSO1340 (acsA-2)
   00620 Pyruvate metabolism
    SSO1340 (acsA-2)
   00640 Propanoate metabolism
    SSO1340 (acsA-2)
  Energy metabolism
   00720 Carbon fixation pathways in prokaryotes
    SSO1340 (acsA-2)
   00680 Methane metabolism
    SSO1340 (acsA-2)
Enzymes [BR:sso01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     SSO1340 (acsA-2)
Lipid biosynthesis proteins [BR:sso01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   SSO1340 (acsA-2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1176148..1176930)
Genome map
AA seq 260 aa AA seqDB search
MRFHPPTALRMIRKEVSSPRRDYDLRLRAVSSAGEAVGGDLIEWAMKELSPNVNEFYGCT
EANLVTVNNSMWRKIGSVGKPTPGHEIAVIDEKGNEVINQVGEIAVRIEDPVLFLGYYKN
PEATAKKFRGHWFLMGDLGLMDQNGYIWFKGRGDDVIKVSGYRLGPEEIESIILQHPAVQ
EVAVIGKPDRLRGNVIKAFIVLKDGYSPSDSLVEEIQQFVKSRLALYAYPREIEFVKELP
RTETGKLKRFELRKREEEKS
NT seq 783 nt NT seq  +upstreamnt  +downstreamnt
ttgcgctttcatccccctacggctttaagaatgattaggaaggaagttagtagtccaagg
agagattacgatttaagattaagagcagttagtagtgctggagaagctgtgggaggagac
ttgattgagtgggcaatgaaagagttatcccccaatgttaatgaattttatggttgtaca
gaggctaatctagtgaccgtaaataactccatgtggcgtaagataggatctgtaggtaaa
cctactcccggtcatgagatagcagtcattgatgaaaaaggtaatgaggtaataaatcaa
gttggagaaatagcagtaaggatagaggatcctgtattatttctaggatattataagaat
ccggaagctaccgctaagaagtttagaggacattggttcttaatgggagacctaggttta
atggatcaaaatggttatatttggtttaaagggagaggggatgacgtaataaaggtttcc
ggctatagattgggaccggaggagatagagagtattatattacaacatcccgcagttcaa
gaagttgctgtaataggtaagccggataggttgagaggaaatgtaataaaggcatttata
gtactaaaggatggatattctccatctgatagtctagtagaggaaattcaacaatttgta
aaaagcagactagccttatatgcgtatcctagagaaatagaattcgttaaagaattacct
agaacggagaccggtaaattgaagagatttgagctaagaaaaagagaagaagaaaaaagt
tga

DBGET integrated database retrieval system