KEGG   Sulfolobus solfataricus P2: SSO1530Help
Entry
SSO1530           CDS       T00054                                 

Gene name
pdhC
Definition
(GenBank) Dihydrolipoamide S-acetyltransferase, carboxy-end (pdhC)
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
sso  Sulfolobus solfataricus P2
Pathway
sso00010  Glycolysis / Gluconeogenesis
sso00020  Citrate cycle (TCA cycle)
sso00620  Pyruvate metabolism
sso01100  Metabolic pathways
sso01110  Biosynthesis of secondary metabolites
sso01120  Microbial metabolism in diverse environments
sso01130  Biosynthesis of antibiotics
sso01200  Carbon metabolism
Module
sso_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:sso00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SSO1530 (pdhC)
   00020 Citrate cycle (TCA cycle)
    SSO1530 (pdhC)
   00620 Pyruvate metabolism
    SSO1530 (pdhC)
Enzymes [BR:sso01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     SSO1530 (pdhC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Transferase CAT AATase
Motif
Other DBs
NCBI-ProteinID: AAK41752
UniProt: Q97Y19
Position
1381020..1381553
Genome map
AA seq 177 aa AA seqDB search
MKITYTDILVKVVAKLLRDHPYLNATLEGDQIKIIEEVNIGIAVALDQGLIVPVIRNADT
KPITEIAKESHELADKARENKLNPDEVSGGTFTISNLGMYDIDSFTPIINPPQTAILGVG
RIRRAPVVVGDNISIGYIMWLSLTFDHRVMDGHTAAKFLKELTEILEDENKLRTFLS
NT seq 534 nt NT seq  +upstreamnt  +downstreamnt
atgaaaattacctatacagatattctagttaaggtagtagctaaactcctcagggaccat
ccatatttaaacgcaacattagagggagatcaaataaagataattgaagaggttaatata
ggaatagctgtggctttggatcaaggattaatagtaccagtaataaggaacgcagatact
aagccaattactgaaatagcgaaagaaagtcatgaactcgctgataaggccagagagaat
aagttaaaccctgatgaagtatctggaggcacgtttacgataagtaatttaggaatgtac
gatatagactcatttacaccaattataaatcctcctcaaactgccatattgggagtaggt
aggataagaagggcaccagtagtagtaggcgataacatctcaattggttatattatgtgg
ctgagtttaacgttcgatcatagagtgatggatggacatactgcagccaagttcctaaaa
gagcttactgaaatattagaggatgaaaacaaattgagaacgtttctaagttag

DBGET integrated database retrieval system