KEGG   Sulfolobus solfataricus P2: SSO1538Help
Entry
SSO1538           CDS       T00054                                 

Gene name
dapE
Definition
(GenBank) Succinyl-diaminopimelate desuccinylase (dapE)
  KO
K01439  succinyl-diaminopimelate desuccinylase [EC:3.5.1.18]
Organism
sso  Sulfolobus solfataricus P2
Pathway
sso00300  Lysine biosynthesis
sso01100  Metabolic pathways
sso01120  Microbial metabolism in diverse environments
sso01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:sso00001]
 Metabolism
  Amino acid metabolism
   00300 Lysine biosynthesis
    SSO1538 (dapE)
Enzymes [BR:sso01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.18  succinyl-diaminopimelate desuccinylase
     SSO1538 (dapE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Peptidase_M20 M20_dimer Peptidase_M28
Motif
Other DBs
NCBI-ProteinID: AAK41759
UniProt: Q97Y12
Position
complement(1390102..1391334)
Genome map
AA seq 410 aa AA seqDB search
MSKIDEIIEELRGEIVDFLKELIRIPTENPPGLNYEKIVNVIKNKLDEFGYKTQVIEPTD
EELKSLIRFGYGKRPNLVGYLGNGNNRIAFNAHYDVVPAGEGWSVDPYKGIEKDGKIYGR
GASDMKSGIVAQIYAIEMLRRAKLLPSNIQVIQTIVPDEETVGNRNAGTYYLVQKGIFKN
VNYVIFTEPTGPDNVCNGHRGAIWAIVRVYGKKSHGGFPQLGIDAVKATSLMIEELYKAI
PDIVSKYEISPESGKKPTILVGVVKCGTWVNTVADYCEFSIVRRLIPEENLEEVRHSIIR
VLDNISKSTGVRYEYDEFYAVNTMRCDDERLISALREKIREVRGVEARTVLSAGTFDIRF
TINEGIKSINYGPGRIELAHANDEYIYVKDLLDSIKVLGLLVLELSNKTK
NT seq 1233 nt NT seq  +upstreamnt  +downstreamnt
atgtcaaaaattgatgagattattgaagaactaagaggggagatagtcgattttttaaag
gagttgataagaatccccactgagaatccccctggattgaattatgagaaaattgttaat
gttataaaaaataaattggatgaatttggttataaaactcaagtaatagagcccactgat
gaagagttgaaaagtctgattagatttggttatggtaaaagacctaatctagttggatat
ttaggtaatggtaacaatagaatagcctttaacgctcattacgatgtagtccctgcagga
gagggatggagtgtagatccctataaaggaatagagaaggacggtaaaatttacgggaga
ggtgcctcagatatgaagtctggtatagttgcgcaaatttacgcaatagagatgttaagg
agagctaaactgttaccatcaaatatccaagtgattcaaacaattgttccagatgaggaa
actgtcggtaataggaatgcaggaacttattatttggtccaaaagggtatatttaagaat
gtaaattacgtcatattcactgagcctactgggccagataatgtgtgtaatggtcatagg
ggtgcaatatgggctattgtaagggtttatggtaagaaaagtcatggtgggtttccacag
ttgggaatcgatgcggttaaagctacctccctaatgatagaagagctttataaggcaatt
cccgatattgtatctaaatacgagatatctccagagtcgggtaaaaagcctaccatatta
gttggcgtggttaaatgcggaacatgggtaaatacggtagcggactattgtgaatttagt
atagtaagaaggctaatcccagaggaaaatttagaggaggtgagacatagcataattagg
gttttggataacataagtaaaagtactggagtaaggtacgaatatgacgaattttatgcg
gtaaatactatgcgttgcgatgatgagagattaataagtgcattgagggaaaagattaga
gaggtaagaggagttgaggctagaaccgtattatcagcagggacatttgatattagattc
actattaatgaagggataaaaagtattaattacggtccaggaagaattgagctagctcat
gctaatgatgagtacatatatgtgaaggacctactggattccatcaaggttttaggacta
ttagtattagaactatccaataagacgaaataa

DBGET integrated database retrieval system