KEGG   Sulfolobus solfataricus P2: SSO1595Help
Entry
SSO1595           CDS       T00054                                 

Gene name
alkK-1
Definition
medium-chain-fatty-acid--CoA ligase (EC:6.2.1.-)
Orthology
K14466  
4-hydroxybutyryl-CoA synthetase (4-hydroxybutyrate-CoA ligase, AMP-forming) [EC:6.2.1.-]
Organism
sso  Sulfolobus solfataricus P2
Pathway
Carbon fixation pathways in prokaryotes
Microbial metabolism in diverse environments
Carbon metabolism
Module
Dicarboxylate-hydroxybutyrate cycle
Hydroxypropionate-hydroxybutylate cycle
Brite
KEGG Orthology (KO) [BR:sso00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    SSO1595 (alkK-1)
  Energy metabolism
   00720 Carbon fixation pathways in prokaryotes
    SSO1595 (alkK-1)
Enzymes [BR:sso01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.-  
     SSO1595 (alkK-1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1439908..1441335
Genome map
AA seq 475 aa AA seqDB search
MMSSVKNEYDAIHRELREQGFIRTDYPPNPSEVLWNKKIMTMKREEIDKLKTFRLRRIIK
WAWENIEFYRRFWKSKNFEPDMIKDWRDIAKIPILRKDEIRKDLQQNPPFGTIFHPELAN
HIRFVGATSGSTGLPTFQGWGALEMDYFQEAQARYLWTFAEVKPTKVYANYLNMSGFYSW
GPPVVETAMWRCGATVIAGGGETYFSWKNRHNLIFKLWKVDVFATTPWLHRLVGEEAKIE
GWETPFKVLLLHGGAAAENTKKKLFKVHPNAELAISVWGTTDGHMAIEVPSLEGQLVVWE
DMEIFDIVDPKTDEPVSGGERGELIATLLNHFTMPLIRYSLGDYVKNDFLTDPDPKYGIT
HMRFAEPIPGRVEWMFFVKGKLLLPIYVEDAVNEIPDTTGMFNIFIYDNSMDKLKIRIET
RREQVNSTYDKQAREILASRIGINPDDVEIEWVKPGNTIWTGYKLQVFVDQRKKK
NT seq 1428 nt NT seq  +upstreamnt  +downstreamnt
ttgatgtcttcagttaaaaacgaatacgatgcaattcatagggaattacgagaacaaggt
tttattagaactgattatcccccaaatccatctgaagtgttatggaataagaagataatg
acaatgaaaagagaggaaatcgataagttaaagacgtttagactaagaaggattataaag
tgggcatgggaaaacattgagttctatagaaggttttggaaatctaaaaacttcgaacca
gacatgataaaggactggagggatatcgctaaaataccgatattgagaaaagatgaaatt
aggaaagacctacagcaaaatcctccatttggtacaattttccatccagaattggctaat
cacataagatttgttggagcgacttctggctcaactggattacctaccttccaaggatgg
ggggctttggaaatggactacttccaagaagcccaggcaaggtacttgtggacttttgcc
gaagttaagccaactaaggtttacgcaaactacctaaacatgagtggcttttatagttgg
gggcctccggttgttgagaccgcaatgtggagatgtggggcaactgtcatagctggaggt
ggtgagacatacttctcatggaagaatagacacaacctgatcttcaaactatggaaagtt
gacgtattcgccacaactccttggctacatagattagtaggagaggaggctaaaattgag
ggttgggaaactcccttcaaggttttgctacttcacggtggtgcagctgctgaaaacact
aaaaagaaattattcaaggttcatccaaatgctgaattagctataagtgtttggggaacc
actgatggacatatggctattgaagttccaagcttagaaggacaattagtagtttgggag
gacatggagatatttgatattgtagaccctaagactgatgaaccagtatctgggggagaa
agaggtgaactgatagcgaccttgttaaatcactttaccatgcctttaatacgctatagt
ttaggagattacgttaagaatgacttcctgaccgatccggatcctaagtatggtataact
cacatgagatttgctgagccaataccaggtagggttgagtggatgttcttcgttaaaggg
aaactattattgccaatttacgttgaggacgctgtgaatgaaattccagacactactgga
atgtttaacattttcatttacgataatagtatggataaattgaagattagaatagagaca
aggagggaacaggttaattctacttacgataagcaagccagagagatattagcgagcagg
attgggattaacccagatgacgttgagatagagtgggtaaagcctggaaatacaatatgg
acgggctacaagttgcaagtgtttgttgaccagaggaagaagaaataa

DBGET integrated database retrieval system