KEGG   Sulfolobus solfataricus P2: SSO1903Help
Entry
SSO1903           CDS       T00054                                 

Gene name
acsA-3
Definition
(RefSeq) hypothetical protein (EC:6.2.1.1)
  KO
K01895  
acetyl-CoA synthetase [EC:6.2.1.1]
Organism
sso  Sulfolobus solfataricus P2
Pathway
Glycolysis / Gluconeogenesis
Pyruvate metabolism
Propanoate metabolism
Methane metabolism
Carbon fixation pathways in prokaryotes
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:sso00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    SSO1903 (acsA-3)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SSO1903 (acsA-3)
   00620 Pyruvate metabolism
    SSO1903 (acsA-3)
   00640 Propanoate metabolism
    SSO1903 (acsA-3)
  Energy metabolism
   00720 Carbon fixation pathways in prokaryotes
    SSO1903 (acsA-3)
   00680 Methane metabolism
    SSO1903 (acsA-3)
Enzymes [BR:sso01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     SSO1903 (acsA-3)
Lipid biosynthesis proteins [BR:sso01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   SSO1903 (acsA-3)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1720018..1721391
Genome map
AA seq 457 aa AA seqDB search
MVSYEEVRRSFSWNEVIKFLDKNPLDVLTSHDGIAIKRFTKDVVEDISFSDLKRKALRLA
LYLREFHDVKKGDVIAVLASKKIEQVIVLLATFSLGAIYQPLFTAFGPEAIKMRTRDAKP
KVIFYQDDQKDKVSDAIPFSKFDELLSYGELKNIEKINWDDPIVLLYTSGTTGAPKGALI
AKRLLLNTYVYMKYGIGIRDSDVFWNPADPGWAYGLYYGIIGPLMFGKTVIFLDEPFNPE
RTMEFMEEKKVTNFAFAPTAYRMIAGTIKRKYDLVLERASSAGEPLNPEVIRWFMDNYNV
TIKDHYGQTEVGMVVYNGWGYETKIKIGSMGLPAPGYEIDVIEDTIAVKRDSPGFHFLGY
LNNPEKTKESFRGDWYLTGDNAYKDEEGYFWFVGRKDDVVKVSGYRVGPFEVESVLLEFP
AVLESAVVADEDPIRGQWCFTKLFHLKDIILVLSKRD
NT seq 1374 nt NT seq  +upstreamnt  +downstreamnt
atggtgagttatgaagaagttagaaggagtttttcatggaatgaggtaattaaattttta
gataagaacccactagacgtgttgacttctcacgatggcatagcaattaaaaggttcact
aaggacgttgtagaggacataagcttctcagatcttaaaagaaaggcgttaagacttgcc
ttatatttaagagagttccatgacgttaagaagggagacgtgatagctgtattggcttca
aagaaaatagaacaagttatagtacttttggcaacgttctctctgggagcaatttatcag
ccattattcactgcatttggaccggaagcgattaagatgaggactagggatgcaaagcca
aaagttatcttttaccaagatgatcaaaaggataaggtaagtgacgcgatacctttctcc
aagttcgatgaattattaagttatggtgaattgaagaatattgaaaagataaattgggat
gacccaatagttttactatacacttctggtactactggagcgcctaaaggagcgctaatc
gctaagagattattactcaacacttatgtttacatgaaatatggtataggtattagggat
agtgacgtattttggaaccctgcagatcctggatgggcttatggattgtattatggtata
ataggaccactgatgttcggaaagaccgttattttccttgacgagccgtttaacccggag
aggacaatggagtttatggaggagaaaaaggttactaattttgccttcgcacccacggca
tataggatgatagctggaacgattaagaggaaatatgatttagtattagaaagagctagt
tctgctggtgaaccacttaacccagaagttataagatggtttatggacaattacaatgtt
actatcaaagatcattacggacaaaccgaagttggaatggttgtttacaacggctgggga
tatgaaacaaaaataaaaatagggagtatgggactaccagctcccggttatgagatagat
gtaatagaggatactatagctgtcaaaagggattcaccgggttttcacttcttaggatat
ttaaataatcctgagaagaccaaggagtcatttagaggcgattggtacttaaccggtgac
aacgcgtataaggatgaggaaggatatttctggtttgttggaaggaaggatgatgtggtt
aaggtatccggttatagggttggaccatttgaagttgagagcgtacttctagaatttccc
gcagtactagagtcggctgttgttgccgacgaagatccaatacggggacagtggtgtttc
accaaattatttcatttgaaagatataatattagtcctttcaaaaagagattga

DBGET integrated database retrieval system