KEGG   Sulfolobus solfataricus P2: SSO2127Help
Entry
SSO2127           CDS       T00054                                 

Definition
transport protein, permease
Orthology
K08177  
MFS transporter, OFA family, oxalate/formate antiporter
Organism
sso  Sulfolobus solfataricus P2
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1953502..1954794
Genome map
AA seq 430 aa AA seqDB search
MMSSKWFEKGWFRWMLVVGATISMALVSVYEYSWTLYTVPLGRVFHVAPGSPALGLTYTI
YIIVQALSMFVAGRIADRYGPRLISMLGGIITGIGYISSAFAKSLPILYLTYGFGSIGVG
IIYGTAISTAVKWFPDKRGLATGIIEIGFGGGSFALSPLIQYIITSISYTAAFTYMGIVQ
LIVITLLAFFFAYPPPQWLPKGFNAEEYEKKRKMIKRSKNDYTVSQMVKTWQWWVIYIAF
FLIAGSGLSIIGHLIPYGRSLGFSIAAVIAVFLFPFANGLGRFVMGTVSDYLGRPYTMTL
SFGISGISMLSIAFIPKIASLYLALIFLTAFTWGPLFSLFPPLVGDYYGPKHSGANYGLT
YTAKALAGIFAGYGASILFTSYGIKETLIITGSMAIMSAILALTLRPPKIPTAQIAGAES
QKGSIESKTK
NT seq 1293 nt NT seq  +upstreamnt  +downstreamnt
atgatgagtagtaagtggtttgaaaaaggatggtttaggtggatgctagtagtaggtgca
actatttctatggcacttgttagtgtgtatgaatattcatggacattatatactgtacct
ctaggtagagtatttcacgtagctccaggatcaccagccctaggacttacatatacaata
tatattatcgtccaagcattatcgatgttcgttgcaggtaggattgcggataggtatggt
cctagactaatttccatgttaggtgggataattactggcattggatatattagctctgcc
tttgctaaatccttgcctatactatatcttacctatggtttcggaagtataggagtgggc
ataatatacggtactgccataagtactgctgtcaaatggttccctgataaaagaggtcta
gccactggaattatagaaataggtttcggtggaggatcattcgcattatcccctttgata
caatatattatcacctcaattagttacacagctgcattcacttacatgggaattgtgcaa
ctaatagttataactctgctggcgttcttctttgcttatcctcctccccaatggttacct
aagggctttaatgctgaggagtacgagaaaaaacgtaagatgataaagagaagcaaaaat
gattatactgtatcgcaaatggtaaagacatggcaatggtgggtaatttatatagcgttt
ttccttattgctggatccggcttatccattattggacatttaataccatacggtagatca
ctaggatttagtatagctgctgtaattgcggtatttttatttccctttgccaatgggtta
ggaagatttgttatgggtactgtatctgactatttaggaagaccttatactatgacgctg
tcatttggaattagtgggatttccatgctctcaatagcattcataccgaagattgcatca
ctataccttgctttgattttcctaacagcattcacgtggggaccattattctctttgttc
ccaccactggtgggtgactattatggacctaaacactctggagctaattatggattaact
tacactgcaaaggcgttagcaggcatatttgccggttatggtgcatcaatattgtttacc
tcatatggcataaaggagacattaattataactggttcaatggctataatgtctgctatc
ctagccttaactctaagaccaccgaaaatacctactgcgcagattgccggtgctgaaagc
cagaaaggtagtatagagtccaaaactaagtaa

DBGET integrated database retrieval system