KEGG   Sulfolobus solfataricus P2: SSO2130Help
Entry
SSO2130           CDS       T00054                                 

Gene name
porB-like
Definition
pyruvate synthase subunit beta (EC:1.2.7.1)
Orthology
K00170  
pyruvate ferredoxin oxidoreductase, beta subunit [EC:1.2.7.1]
Organism
sso  Sulfolobus solfataricus P2
Pathway
Glycolysis / Gluconeogenesis
Citrate cycle (TCA cycle)
Pyruvate metabolism
Nitrotoluene degradation
Propanoate metabolism
Butanoate metabolism
Methane metabolism
Carbon fixation pathways in prokaryotes
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
Pyruvate oxidation, pyruvate => acetyl-CoA
Dicarboxylate-hydroxybutyrate cycle
Brite
KEGG Orthology (KO) [BR:sso00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    SSO2130 (porB-like)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SSO2130 (porB-like)
   00020 Citrate cycle (TCA cycle)
    SSO2130 (porB-like)
   00620 Pyruvate metabolism
    SSO2130 (porB-like)
   00640 Propanoate metabolism
    SSO2130 (porB-like)
   00650 Butanoate metabolism
    SSO2130 (porB-like)
  Energy metabolism
   00720 Carbon fixation pathways in prokaryotes
    SSO2130 (porB-like)
   00680 Methane metabolism
    SSO2130 (porB-like)
  Xenobiotics biodegradation and metabolism
   00633 Nitrotoluene degradation
    SSO2130 (porB-like)
Enzymes [BR:sso01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.1  pyruvate synthase
     SSO2130 (porB-like)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1957357..1958373
Genome map
AA seq 338 aa AA seqDB search
MVEKELEEKVYKSIIKTIKDTPLEEFYTSGHRTCQGCESALVMRFLAKAAGPRTIVIGAT
GCMYVANTTYYTTSWIVPWVHTQLGGTGAAALGTAAALRALMRKGKIKQEPINVIAFCGD
LGCADMGLSGVSNAMTYDYNLLIILYDNESSANTDIQETSMTPFGAQTSFSRPGKQRRIM
KKRWKKSVVPMIIAGHRNVRYAATMTPAYPLDSMNKIRKALTIGGPTFIHSLDPCPKGWD
YDPKFSHELGVLAVETGLWPLYEYIDGEIVYNEPTKSIVEGRMKRKPVKEYLEKQGRFSH
FTEEDIEYVQRMVDEMYEEWEIPGVMPIKSINAKISDK
NT seq 1017 nt NT seq  +upstreamnt  +downstreamnt
atggttgaaaaggaattggaagaaaaagtgtataagtctataattaagacaataaaagac
acaccgttagaggagttctatacatctggtcataggacttgccaaggatgcgagtcggca
ctagtgatgagatttttagctaaagctgctggaccaagaacaatagttataggagctact
ggatgcatgtatgtagcaaatactacatattatactacgtcatggatagttccatgggtt
cacacacaactgggaggaacaggtgcagctgcattaggtactgccgctgcacttagggca
ttaatgaggaaaggaaaaataaagcaagaacctataaacgtgatagccttctgtggagac
ctaggatgcgcggatatgggtttatctggagtttcaaatgcaatgacttatgattataac
ttactcataatactttatgataatgagtcctcagcaaatactgatattcaggagactagt
atgacaccatttggagcgcaaacatcatttagtagacccggtaaacaaagaagaataatg
aagaaaaggtggaaaaagagcgtagtcccaatgataatagctggacataggaacgttaga
tatgcagccactatgactcctgcctatccactggactccatgaataagatcagaaaggca
ttaacgatagggggaccaacgttcattcattcgttagacccgtgcccgaagggatgggat
tacgatccgaaattctctcacgaactgggagtattggcagtagagacaggattatggcca
ctatatgaatatatagatggagagatagtgtacaatgagcctaccaagagcatagtagag
ggtagaatgaagagaaaaccagtaaaagagtacttagaaaagcaaggaagattttcacat
tttactgaagaagacattgaatacgtccaaagaatggttgacgagatgtatgaagaatgg
gaaatacctggggtaatgccaataaagtcaataaatgcgaagataagtgataaataa

DBGET integrated database retrieval system