KEGG   Sulfolobus solfataricus P2: SSO2130Help
Entry
SSO2130           CDS       T00054                                 

Gene name
porB-like
Definition
pyruvate synthase subunit beta (EC:1.2.7.1)
Orthology
K00170  
pyruvate ferredoxin oxidoreductase, beta subunit [EC:1.2.7.1]
Organism
sso  Sulfolobus solfataricus P2
Pathway
Glycolysis / Gluconeogenesis
Citrate cycle (TCA cycle)
Pyruvate metabolism
Nitrotoluene degradation
Propanoate metabolism
Butanoate metabolism
Methane metabolism
Carbon fixation pathways in prokaryotes
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
Pyruvate oxidation, pyruvate => acetyl-CoA
Pyruvate:ferredoxin oxidoreductase
Dicarboxylate-hydroxybutyrate cycle
Class
Metabolism; Overview; Carbon metabolism [PATH:sso01200]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:sso00010]
Metabolism; Carbohydrate metabolism; Citrate cycle (TCA cycle) [PATH:sso00020]
Metabolism; Carbohydrate metabolism; Pyruvate metabolism [PATH:sso00620]
Metabolism; Carbohydrate metabolism; Propanoate metabolism [PATH:sso00640]
Metabolism; Carbohydrate metabolism; Butanoate metabolism [PATH:sso00650]
Metabolism; Energy metabolism; Carbon fixation pathways in prokaryotes [PATH:sso00720]
Metabolism; Energy metabolism; Methane metabolism [PATH:sso00680]
Metabolism; Xenobiotics biodegradation and metabolism; Nitrotoluene degradation [PATH:sso00633]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1957357..1958373
Genome map
AA seq 338 aa AA seqDB search
MVEKELEEKVYKSIIKTIKDTPLEEFYTSGHRTCQGCESALVMRFLAKAAGPRTIVIGAT
GCMYVANTTYYTTSWIVPWVHTQLGGTGAAALGTAAALRALMRKGKIKQEPINVIAFCGD
LGCADMGLSGVSNAMTYDYNLLIILYDNESSANTDIQETSMTPFGAQTSFSRPGKQRRIM
KKRWKKSVVPMIIAGHRNVRYAATMTPAYPLDSMNKIRKALTIGGPTFIHSLDPCPKGWD
YDPKFSHELGVLAVETGLWPLYEYIDGEIVYNEPTKSIVEGRMKRKPVKEYLEKQGRFSH
FTEEDIEYVQRMVDEMYEEWEIPGVMPIKSINAKISDK
NT seq 1017 nt NT seq  +upstreamnt  +downstreamnt
atggttgaaaaggaattggaagaaaaagtgtataagtctataattaagacaataaaagac
acaccgttagaggagttctatacatctggtcataggacttgccaaggatgcgagtcggca
ctagtgatgagatttttagctaaagctgctggaccaagaacaatagttataggagctact
ggatgcatgtatgtagcaaatactacatattatactacgtcatggatagttccatgggtt
cacacacaactgggaggaacaggtgcagctgcattaggtactgccgctgcacttagggca
ttaatgaggaaaggaaaaataaagcaagaacctataaacgtgatagccttctgtggagac
ctaggatgcgcggatatgggtttatctggagtttcaaatgcaatgacttatgattataac
ttactcataatactttatgataatgagtcctcagcaaatactgatattcaggagactagt
atgacaccatttggagcgcaaacatcatttagtagacccggtaaacaaagaagaataatg
aagaaaaggtggaaaaagagcgtagtcccaatgataatagctggacataggaacgttaga
tatgcagccactatgactcctgcctatccactggactccatgaataagatcagaaaggca
ttaacgatagggggaccaacgttcattcattcgttagacccgtgcccgaagggatgggat
tacgatccgaaattctctcacgaactgggagtattggcagtagagacaggattatggcca
ctatatgaatatatagatggagagatagtgtacaatgagcctaccaagagcatagtagag
ggtagaatgaagagaaaaccagtaaaagagtacttagaaaagcaaggaagattttcacat
tttactgaagaagacattgaatacgtccaaagaatggttgacgagatgtatgaagaatgg
gaaatacctggggtaatgccaataaagtcaataaatgcgaagataagtgataaataa

DBGET integrated database retrieval system