KEGG   Sulfolobus solfataricus P2: SSO2133Help
Entry
SSO2133           CDS       T00054                                 

Gene name
glpK-2
Definition
glycerol kinase (EC:2.7.1.30)
Orthology
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
sso  Sulfolobus solfataricus P2
Pathway
Glycerolipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sso00001]
 Metabolism
  Lipid metabolism
   00561 Glycerolipid metabolism
    SSO2133 (glpK-2)
Enzymes [BR:sso01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.30  glycerol kinase
     SSO2133 (glpK-2)
Exosome [BR:sso04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   SSO2133 (glpK-2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1960696..1962195
Genome map
AA seq 499 aa AA seqDB search
MPGGFILAIDEGTTSARAIIYNQDLEVLGIGQYDFPQHYPSPGYVEHNPDEIWNAQMLAI
KEAMKKAKIESRQVAGIGVTNQRETTILWDAISGKPIYNAIVWQDRRTSNITDWLKENYF
GMIKDKTGLIPDPYFSGSKIKWILDNLPNVRSKAEKGEIKFGTIDTYLIWKLTNGKIHVT
DYSNASRTMLFNINKLEWDREILELLKIPESILPEVRPSSDIYGYTEVLGSSIPISGDAG
DQQAALFGQVAYDMGEVKSTYGTGSFILMNIGSNPIFSENLLTTIAWGLESKRVTYALEG
SIFITGAAVQWFRDGLRAIDASDDIEPLAASVPDTGGVYFVPAFVGLGAPYWDPYARGLI
IGITRGTTKAHIARAILESIAYQNRDVIEIMEKESGTKINILKVDGGGAKDNLLMQFQAD
ILGIRVVRPKVMETASMGVAMLAGLAINYWNSLNELKQKWTVDKEFIPSINKEERERRYN
AWKEAVKRSLGWEKSLGSK
NT seq 1500 nt NT seq  +upstreamnt  +downstreamnt
atgcccggtggcttcatcttagcaatagatgagggaacaacaagtgctagagcaattata
tataatcaagatttagaagtattaggaataggtcagtacgattttcctcaacattaccca
agtccaggatatgtagagcacaatcccgatgagatatggaatgcacaaatgttagcaata
aaagaagctatgaaaaaggcgaagatagagtctaggcaagtagctggaatcggagtgact
aatcagagggagactaccatattatgggatgcgataagtgggaaaccaatttacaatgca
attgtttggcaagatagaagaacttctaatataactgattggctaaaggagaattacttt
ggtatgataaaggataaaaccgggcttattcctgacccttactttagtggatctaaaata
aagtggatattggataatctccctaatgtgaggagtaaggcagaaaagggcgaaataaag
tttggaactatagatacttatcttatatggaagttaactaatggtaagattcacgtaact
gattattcaaacgcgtcaagaaccatgctattcaacataaataagctagaatgggataga
gaaatcttggaattattgaaaattccagagagtatattacctgaagtgagaccatctagc
gatatttacgggtatactgaagttttgggatcctctattccaatctctggtgatgccgga
gatcaacaagctgccttgtttggtcaagtagcctatgacatgggcgaagtaaaatcaacc
tatgggactggaagtttcattctgatgaatataggtagcaatccgattttttcagaaaat
ttactaaccactatagcttggggtttagagagtaaaagggttacatatgctttagaagga
agtatattcataactggtgcggcagtacagtggtttagagatggtttaagagcaatagat
gcatcggatgacatcgagccattagccgcaagtgtaccggatactggtggtgtctatttc
gtaccagcatttgtcgggttaggtgcaccatactgggatccatacgcgaggggattgata
ataggtattacgagggggactacaaaggctcatatagctagagcaatactcgaatcaata
gcataccaaaatagagacgtaatagaaataatggagaaagagtctgggactaagataaac
atactaaaggttgatggtggtggggctaaggacaatttactgatgcaatttcaagcagat
attttgggaattagggtagtaaggccgaaggtaatggagactgcatctatgggcgttgca
atgttagcaggtttagcaataaattattggaattcacttaacgaattgaaacaaaaatgg
actgtcgacaaagagttcattccctcaatcaataaagaagaaagggaaagacgctataat
gcgtggaaagaggcagtgaagaggtcgctgggttgggaaaaatcgttaggtagtaaataa

  All links  
No link information was found.   
DBGET integrated database retrieval system