KEGG   Sulfolobus solfataricus P2: SSO2216Help
Entry
SSO2216           CDS       T00054                                 

Gene name
acsA-8
Definition
(RefSeq) acetyl-CoA synthetase (EC:6.2.1.1)
  KO
K01895  
acetyl-CoA synthetase [EC:6.2.1.1]
Organism
sso  Sulfolobus solfataricus P2
Pathway
Glycolysis / Gluconeogenesis
Pyruvate metabolism
Propanoate metabolism
Methane metabolism
Carbon fixation pathways in prokaryotes
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:sso00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    SSO2216 (acsA-8)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SSO2216 (acsA-8)
   00620 Pyruvate metabolism
    SSO2216 (acsA-8)
   00640 Propanoate metabolism
    SSO2216 (acsA-8)
  Energy metabolism
   00720 Carbon fixation pathways in prokaryotes
    SSO2216 (acsA-8)
   00680 Methane metabolism
    SSO2216 (acsA-8)
Enzymes [BR:sso01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     SSO2216 (acsA-8)
Lipid biosynthesis proteins [BR:sso01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   SSO2216 (acsA-8)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2038638..2040353)
Genome map
AA seq 571 aa AA seqDB search
MDYYTLYDLSLEKPETYWETFANRLSFFKKWEKVIEKNKQLPIAKWFINGTTNIAYNALN
HGGKALIFYQENKHKGDEITFDELNNMSSMIAGLLLDKGVRRGDRIAIYMPNSICTIATI
LAAARLGAIYTLIFAGLGINAIVSRISNLEPKLVISIDKTFRRGKEIKLYTNLANIVFPR
DSSQFDYTREYKEFEKIESNEPLKIMYTSGTTGKPKGVILPHGAWMVGDYTVFDLMFSLK
SDDIVLTTADVGWITFSRIMYGTLMHGSTLAFMEGAPDYPSDRLPKIIDELQPKVLFTSP
TLLRTLQKLDVKLPRVEFIATAGEIMDETAWKYALRFSDRVADVYGQTELGYVIGYPYAL
DGVEPKIGYAGLPFPAAVIDTVDENGKSLRGHIGHLVAREPFPTQFIGIWKDEDKFLSYF
EKFNSHDTGDLAIIDEKGYVKIVGRDDDMIKIAGHRITSGEVESVINSLQGIIESAAVGI
PDEIKGEKLVVFYVGNVDERIVATKVREMLGPIYVIDKIYKVERLPKSRSGKIVRRVLRD
LLLGKEIDETILEDPEILKEIKNEIKRSERI
NT seq 1716 nt NT seq  +upstreamnt  +downstreamnt
atggactactacacactttacgacctttccttagaaaaaccagaaacctactgggaaacg
tttgctaataggttatcattctttaagaaatgggaaaaagtcatagaaaaaaataaacaa
ttacccatagctaaatggttcattaacggtactacaaatattgcatataacgcccttaat
cacggtggtaaggcccttatattttaccaagagaataaacataaaggagatgaaattaca
ttcgatgagttaaataatatgagttcaatgattgctggattattactagataaaggggta
agaagaggagatagaattgcgatttatatgcctaactcaatatgtacgatagctacgata
ctagctgcggctagactaggagcaatttatacgctcatttttgcaggattaggaataaat
gctatagtaagtaggatttcaaatctggaacctaaattagtaatctccatagataagaca
ttcagaaggggaaaggaaataaaactatatactaacttagccaatatagtatttccgagg
gactcctcgcaatttgactatacaagagaatataaagaatttgagaaaatagaaagtaat
gaaccattgaaaataatgtatacttctggaacaacgggtaaacctaaaggtgtaatctta
ccacatggagcttggatggtaggagattatacagtatttgacttaatgttttcattaaag
agtgacgatatagttctaacaactgcagatgtgggatggataacgttctcaagaataatg
tatggaactctaatgcatggctccacgttggcatttatggaaggagcgccagactatcca
tcggatagattgccaaaaattattgacgagttacagcctaaagtattatttacatcccct
acactccttagaactttacaaaagttagatgtgaaacttccaagagtggagtttatagcc
acagcaggagagataatggatgaaactgcatggaaatacgcattaaggttttctgataga
gttgcagatgtatatgggcaaactgagttaggttatgtaataggctatccttatgcgtta
gatggtgtagaaccaaaaataggatatgctggattgccatttccagctgcagttatagac
acagtagacgaaaatgggaaaagtttaagaggacatattggtcatctagtcgcaagagaa
ccatttcctacccaatttattggaatttggaaagatgaagacaaatttttaagctatttt
gaaaaattcaacagccacgatactggggatctagccataattgatgagaaaggttatgtt
aaaatagttggtagagatgacgatatgataaagatagctggacatagaataactagtgga
gaagtagaaagtgtaataaattccttgcaaggaataattgaatcagctgctgtaggaata
ccggatgagataaagggtgaaaaattagtagtattttatgtgggaaacgtagacgaaaga
atagtagcaacaaaggttagggaaatgttggggcctatatatgtcattgacaaaatatat
aaggttgaaagactaccgaagtctcgaagtggtaaaatagttagaagagttttgagagat
ttattattgggaaaagaaatagatgaaactatattggaagacccagaaatattaaaggag
atcaaaaatgagattaagagatccgagagaatttag

DBGET integrated database retrieval system