KEGG   Sulfolobus solfataricus P2: SSO2216Help
Entry
SSO2216           CDS       T00054                                 

Gene name
acsA-8
Definition
(GenBank) Acetyl-CoA synthetase (acetate-CoA ligase) (acsA-8)
  KO
K01895  acetyl-CoA synthetase [EC:6.2.1.1]
Organism
sso  Sulfolobus solfataricus P2
Pathway
sso00010  Glycolysis / Gluconeogenesis
sso00620  Pyruvate metabolism
sso00640  Propanoate metabolism
sso00680  Methane metabolism
sso00720  Carbon fixation pathways in prokaryotes
sso01100  Metabolic pathways
sso01110  Biosynthesis of secondary metabolites
sso01120  Microbial metabolism in diverse environments
sso01130  Biosynthesis of antibiotics
sso01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:sso00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SSO2216 (acsA-8)
   00620 Pyruvate metabolism
    SSO2216 (acsA-8)
   00640 Propanoate metabolism
    SSO2216 (acsA-8)
  Energy metabolism
   00720 Carbon fixation pathways in prokaryotes
    SSO2216 (acsA-8)
   00680 Methane metabolism
    SSO2216 (acsA-8)
Enzymes [BR:sso01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     SSO2216 (acsA-8)
Lipid biosynthesis proteins [BR:sso01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   SSO2216 (acsA-8)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AMP-binding ACAS_N AMP-binding_C
Motif
Other DBs
NCBI-ProteinID: AAK42386
UniProt: Q97WK0
Position
complement(2038638..2040353)
Genome map
AA seq 571 aa AA seqDB search
MDYYTLYDLSLEKPETYWETFANRLSFFKKWEKVIEKNKQLPIAKWFINGTTNIAYNALN
HGGKALIFYQENKHKGDEITFDELNNMSSMIAGLLLDKGVRRGDRIAIYMPNSICTIATI
LAAARLGAIYTLIFAGLGINAIVSRISNLEPKLVISIDKTFRRGKEIKLYTNLANIVFPR
DSSQFDYTREYKEFEKIESNEPLKIMYTSGTTGKPKGVILPHGAWMVGDYTVFDLMFSLK
SDDIVLTTADVGWITFSRIMYGTLMHGSTLAFMEGAPDYPSDRLPKIIDELQPKVLFTSP
TLLRTLQKLDVKLPRVEFIATAGEIMDETAWKYALRFSDRVADVYGQTELGYVIGYPYAL
DGVEPKIGYAGLPFPAAVIDTVDENGKSLRGHIGHLVAREPFPTQFIGIWKDEDKFLSYF
EKFNSHDTGDLAIIDEKGYVKIVGRDDDMIKIAGHRITSGEVESVINSLQGIIESAAVGI
PDEIKGEKLVVFYVGNVDERIVATKVREMLGPIYVIDKIYKVERLPKSRSGKIVRRVLRD
LLLGKEIDETILEDPEILKEIKNEIKRSERI
NT seq 1716 nt NT seq  +upstreamnt  +downstreamnt
atggactactacacactttacgacctttccttagaaaaaccagaaacctactgggaaacg
tttgctaataggttatcattctttaagaaatgggaaaaagtcatagaaaaaaataaacaa
ttacccatagctaaatggttcattaacggtactacaaatattgcatataacgcccttaat
cacggtggtaaggcccttatattttaccaagagaataaacataaaggagatgaaattaca
ttcgatgagttaaataatatgagttcaatgattgctggattattactagataaaggggta
agaagaggagatagaattgcgatttatatgcctaactcaatatgtacgatagctacgata
ctagctgcggctagactaggagcaatttatacgctcatttttgcaggattaggaataaat
gctatagtaagtaggatttcaaatctggaacctaaattagtaatctccatagataagaca
ttcagaaggggaaaggaaataaaactatatactaacttagccaatatagtatttccgagg
gactcctcgcaatttgactatacaagagaatataaagaatttgagaaaatagaaagtaat
gaaccattgaaaataatgtatacttctggaacaacgggtaaacctaaaggtgtaatctta
ccacatggagcttggatggtaggagattatacagtatttgacttaatgttttcattaaag
agtgacgatatagttctaacaactgcagatgtgggatggataacgttctcaagaataatg
tatggaactctaatgcatggctccacgttggcatttatggaaggagcgccagactatcca
tcggatagattgccaaaaattattgacgagttacagcctaaagtattatttacatcccct
acactccttagaactttacaaaagttagatgtgaaacttccaagagtggagtttatagcc
acagcaggagagataatggatgaaactgcatggaaatacgcattaaggttttctgataga
gttgcagatgtatatgggcaaactgagttaggttatgtaataggctatccttatgcgtta
gatggtgtagaaccaaaaataggatatgctggattgccatttccagctgcagttatagac
acagtagacgaaaatgggaaaagtttaagaggacatattggtcatctagtcgcaagagaa
ccatttcctacccaatttattggaatttggaaagatgaagacaaatttttaagctatttt
gaaaaattcaacagccacgatactggggatctagccataattgatgagaaaggttatgtt
aaaatagttggtagagatgacgatatgataaagatagctggacatagaataactagtgga
gaagtagaaagtgtaataaattccttgcaaggaataattgaatcagctgctgtaggaata
ccggatgagataaagggtgaaaaattagtagtattttatgtgggaaacgtagacgaaaga
atagtagcaacaaaggttagggaaatgttggggcctatatatgtcattgacaaaatatat
aaggttgaaagactaccgaagtctcgaagtggtaaaatagttagaagagttttgagagat
ttattattgggaaaagaaatagatgaaactatattggaagacccagaaatattaaaggag
atcaaaaatgagattaagagatccgagagaatttag

DBGET integrated database retrieval system