KEGG   Sulfolobus solfataricus P2: SSO2449Help
Entry
SSO2449           CDS       T00054                                 

Gene name
rbsK-2
Definition
ribokinase (rbsK-2) (EC:2.7.1.15)
Orthology
K00852  
ribokinase [EC:2.7.1.15]
Organism
sso  Sulfolobus solfataricus P2
Pathway
Pentose phosphate pathway
Brite
KEGG Orthology (KO) [BR:sso00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    SSO2449 (rbsK-2)
Enzymes [BR:sso01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.15  ribokinase
     SSO2449 (rbsK-2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2221030..2221881)
Genome map
AA seq 283 aa AA seqDB search
MIHLAVGRFNIDIIVKLDSIPPIDSSHMTDVLEIMPGGAATNYAVAVTKLGHSAKLLAKV
GKSEVVRSLMEKVVELGVGLEYVEELNEKPSATLIFLRNDGTLSMVRRLGASILLTREDV
KRRFGLFDVIHFASVSPNVVVRDPYAKLVSYDPGPQAKNIESVDVDILYVNEKEYEMIED
KNIRARFIVIKMGKKGAKIITETEECSVEPIQVEKIVDTTGAGDTFDAAFNVTYSEDKDI
VKSLQVASVASGLKVSRIGGISSPTLEEVREYLRKKKPNVICK
NT seq 852 nt NT seq  +upstreamnt  +downstreamnt
ttgatacatctggcagtgggaagatttaacattgatatcatagtaaaattggattctatt
ccacccatagactctagccatatgaccgatgttcttgaaatcatgcctggaggagctgca
acaaactacgcagtagcagtgaccaaattaggtcactcggccaaactattagcaaaggtt
gggaaaagtgaagtagttagaagtttaatggagaaggtagtagaattaggagtaggatta
gagtacgtagaagaactaaatgagaaacctagcgccacattaatcttcttaagaaatgat
ggaacgctatctatggtaagaagacttggtgcatcaatattactaacaagagaggatgtt
aaaaggcgttttggactgtttgacgttattcacttcgcctcagtatcgccaaacgtcgtt
gtgagagacccttatgcaaaactagtaagttacgatcctggtccgcaggctaaaaatata
gagtcagttgacgtagatatcctatatgttaatgaaaaagaatatgaaatgatcgaagat
aagaacataagagccagatttatagtgattaaaatgggcaagaaaggggcaaagataatt
accgagactgaagaatgttcggttgaaccaatacaagtagagaagatagttgatactacc
ggagctggagatacctttgatgctgcatttaatgtgacatactctgaagataaggatatt
gtgaaaagtctacaagttgctagtgttgcatcaggtcttaaggtctcaagaataggagga
atttcttcaccaacattagaagaggtaagagagtatttaaggaagaagaaaccaaatgtt
atatgtaaatga

DBGET integrated database retrieval system