KEGG   Sulfolobus solfataricus P2: SSO2473Help
Entry
SSO2473           CDS       T00054                                 

Definition
glucan 1,3-alpha-glucosidase (EC:3.2.1.3)
Orthology
K01178  
glucoamylase [EC:3.2.1.3]
Organism
sso  Sulfolobus solfataricus P2
Pathway
Starch and sucrose metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:sso00500]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2243888..2245726
Genome map
AA seq 612 aa AA seqDB search
MTRYLILGNGSLTVLYDSNFTIREIYWPLTTTNNLHRGRFGVFVNGKFSWLDNLNPKIGY
LDDTLAAYSSFSFEGVNFYLEDVIDMAYDIWIRKVSVKDVKDRDVRVFTAFDFHVGGTPD
GNTALFDPYSESMIQYKGSRWFLLSSPIPFYQYATGIKEYKGLLGTWKDCEDGELSGNPI
AQGSVDFASSFKLYGEDLYIWLVAGKNYNEAKGLSDYVRKRTPAILFKRVKDYWRAWLSK
VNDYGEYDSILRRSLLILQSHVQNNGAIVASLDTDIMKFNRDTYNYVWHRDAVFCILALE
LMGYFDRSRQFFEFTRRLFTINGALFHKYTVDGHFGSTWHPWTLDYLPIQEDETALVLYA
LWFHFSKWKDVDFIKTYYRPMVKGIADFLVNYREKATGLPLPSFDLWEERIGTHFYTTIT
VIAGLRAAADFARYFGEDELAQKYETVADQMRNSLDLFWVGDHYARTIYMKEGQVHKIDE
TVDSSILLAPIFNVIPMSDSRFVKNLETVIEKLSVKRGLVRYEGDQYLRGGNNSNIWFIS
TLWLSQVYSLMGEKDKAKEKIDWVLSKSLPTGVIPEQIDDNDKYPSVSPLAWSHAELIRA
IYALRNGTLDPK
NT seq 1839 nt NT seq  +upstreamnt  +downstreamnt
atgactagatatttgatcttgggaaacggttcattgacagttctatacgatagtaatttt
acaataagggaaatatactggccattaactactacaaataatttacataggggcaggttt
ggtgtttttgttaatggtaagttctcatggttagataatttaaatccaaagattggatat
ttagatgatactttagcggcatattcatctttttcctttgagggagtgaatttttattta
gaagatgtaatagatatggcttatgatatttggataaggaaagtttcagtaaaagacgta
aaggatagggacgttagagtttttaccgcttttgattttcatgttgggggaacaccagat
ggtaatactgcactttttgacccttattctgagtctatgatacaatataaaggttctaga
tggtttttactttcatctccgattcccttctatcagtacgctacgggaattaaggaatat
aagggacttttagggacatggaaagattgcgaagatggtgaactttccggtaatccaatt
gctcaaggttcagttgattttgctagtagtttcaaattgtatggagaagatttatatata
tggttagtagccggtaaaaattataatgaagctaagggtttaagcgattacgtgaggaag
agaacacccgcgattttattcaagagggttaaggactattggagagcgtggttaagtaaa
gtaaacgattacggtgaatacgattcgattttaaggagaagtttactgattttgcaatcc
catgtacagaacaacggtgccatagtagcgtcactagatactgatattatgaagtttaat
agggacacatataactacgtgtggcatagagatgctgtattctgtattttagctcttgaa
ctaatggggtattttgatagatctagacagttctttgaattcactaggaggctcttcaca
ataaacggtgcgctatttcataaatatactgttgatggacatttcggttccacatggcat
ccctggactttggactatttgcctattcaagaagatgagactgcattagtactttacgcc
ttatggtttcatttttcaaagtggaaagatgttgattttataaagacttactataggccc
atggttaagggtatagctgattttctagtaaattatagagaaaaggctaccggtcttcca
cttccctcattcgatctatgggaagagaggattggtactcacttttatactacaataact
gtaatcgcaggattaagggctgcagcggattttgcaagatattttggagaagacgagcta
gcacaaaaatatgaaactgttgcagatcaaatgcgtaattcattagatttattctgggtt
ggtgatcattacgctagaacgatatatatgaaggaaggtcaagttcataagatcgatgaa
actgttgactcaagtatattgttggcaccaatatttaatgtaattccgatgagcgactcc
cgttttgtaaagaatttagagactgttatagagaagttaagtgttaaaaggggattagtt
aggtatgagggtgatcaatatttaagaggaggtaataattccaatatctggtttatatct
acattatggttatctcaagtttattcgttaatgggtgagaaagataaggctaaggaaaag
atagattgggtcttgtcgaaatctttaccaactggagttataccagaacaaattgacgat
aatgacaaatatccatcagtttctcccttagcgtggagccacgcagagttaataagggca
atatatgcattaagaaatggcacattagatcctaaataa

DBGET integrated database retrieval system