KEGG   Sulfolobus solfataricus P2: SSO2494Help
Entry
SSO2494           CDS       T00054                                 

Gene name
adh-8
Definition
alcohol dehydrogenase (EC:1.1.1.1)
Orthology
K00001  
alcohol dehydrogenase [EC:1.1.1.1]
Organism
sso  Sulfolobus solfataricus P2
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Tyrosine metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:sso00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    SSO2494 (adh-8)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SSO2494 (adh-8)
  Lipid metabolism
   00071 Fatty acid degradation
    SSO2494 (adh-8)
  Amino acid metabolism
   00350 Tyrosine metabolism
    SSO2494 (adh-8)
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    SSO2494 (adh-8)
   00626 Naphthalene degradation
    SSO2494 (adh-8)
Enzymes [BR:sso01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     SSO2494 (adh-8)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2264548..2265558
Genome map
AA seq 336 aa AA seqDB search
MKAVILPAHKQGYRIEEVPDPKPGKDEAIIKVNKAALCYRDLLQIKGFYPRSKYPLILGH
EVVGTVEEVGEDVKDFKKGDRVTSMLFVPDWSCEYCKSGEEVYCKNRVVYAQELDGFFAE
KAKVKASSLVKVPESVSDEGAVIVPCVAAMVYRGLKKAGIKKGEIVLVTGASGGVGIHAI
QVAKALGAKVIGVTSGESKAKIVSKYADYVIVGEKFSEEAKKIGDVSIVIENVGPYTLEE
SMKSLRSGGKIIQIGNLDPSVTFNLRLGYIILKDISLMGHIGANKNDIIKTLNLVKEGKI
KPVIGSEVSLENFGKALDLLNDSKNRYGKILISNSF
NT seq 1011 nt NT seq  +upstreamnt  +downstreamnt
atgaaagctgttattcttccagctcataaacaaggttatagaattgaggaagtaccagat
cctaaaccgggtaaggatgaagccattattaaggttaacaaggctgcactgtgttatagg
gacttattgcaaataaaaggattctaccccagatctaaatacccgttaattttaggtcat
gaagttgtgggaactgtagaggaagttggagaagacgttaaggattttaagaaaggggat
agagttacgtcaatgctttttgtccctgactggtcatgtgaatattgtaaaagtggagaa
gaagtttattgtaagaatagggttgtatacgctcaagaattagatggatttttcgcagaa
aaagctaaagttaaggcaagcagtctagttaaagtacctgagagtgtttccgatgaggga
gctgttatagtaccatgtgttgctgcaatggtttataggggtttgaaaaaagctggaata
aaaaaaggagaaattgtattggttactggagcaagtggtggtgtaggtattcatgctatt
caagtagctaaggctttaggggctaaggtaataggagttactagtggggaaagcaaggct
aagatagtttctaaatatgctgactacgtaattgtaggtgagaagttctcagaagaggct
aaaaagataggtgacgtttccattgtaattgaaaatgtgggtccctatacgctagaagaa
agtatgaagagtctgaggagtggcggtaagattatacagatcggtaatttagatccttct
gtaacatttaatttaaggctgggctatattattcttaaagacataagtttaatggggcat
ataggcgcaaataaaaatgatataataaaaactctaaaccttgttaaggagggtaaaata
aaacctgttattggaagtgaggttagcttagagaattttggaaaagctcttgacttgctt
aatgacagtaaaaataggtacggaaaaatattgatctcaaactctttctag

DBGET integrated database retrieval system