KEGG   Sulfolobus solfataricus P2: SSO2592Help
Entry
SSO2592           CDS       T00054                                 

Gene name
tpiA
Definition
triosephosphate isomerase (EC:5.3.1.1)
Orthology
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
sso  Sulfolobus solfataricus P2
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:sso00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    SSO2592 (tpiA)
   01230 Biosynthesis of amino acids
    SSO2592 (tpiA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SSO2592 (tpiA)
   00051 Fructose and mannose metabolism
    SSO2592 (tpiA)
   00562 Inositol phosphate metabolism
    SSO2592 (tpiA)
Enzymes [BR:sso01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     SSO2592 (tpiA)
Exosome [BR:sso04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   SSO2592 (tpiA)
  Exosomal proteins of bladder cancer cells
   SSO2592 (tpiA)
  Exosomal proteins of melanoma cells
   SSO2592 (tpiA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2358713..2359396
Genome map
AA seq 227 aa AA seqDB search
MKPPIIIINFKAYENSFGDKAVNLGKKIEKISKEYSVEIILSTPATMIYRMSQEVDLPIY
AEHVDPVPLGAFTGAILPEMVKDAGAKGTLINHSERRLRADEIDDVLKRTKKLGLKSILC
VDRYELVYPFSLLKPDAILIEPPELIGTGVSVSKAKPEVITRAVDEIRKSEGIYLIAGAG
ITTGEDVYKALKLGAHGIGVASAVMKAKEPEKVVEDFITSALRAISS
NT seq 684 nt NT seq  +upstreamnt  +downstreamnt
gtgaaacctcctattattataataaactttaaggcatacgagaactcgtttggtgataaa
gcagtaaatttaggtaaaaaaatagaaaaaataagtaaagagtactcagttgaaatcata
ttgtcaacaccagccaccatgatatatagaatgtctcaggaagtagatttaccaatttat
gctgaacatgtagacccagtacctttaggagcatttactggagcgatattaccagaaatg
gtaaaagatgcaggtgctaagggtactttaataaatcacagtgagagacgtctaagagct
gatgaaatagatgatgtgctaaaaaggaccaaaaaattaggtttaaagagtatattatgt
gttgacagatatgaattggtatatccctttagtttgctgaaacctgacgcaattttaata
gagcccccagaattgataggaactggtgtctcagtttcgaaggctaaacctgaggtaata
actagagctgtagatgagataagaaagtccgagggaatatatctaatagcaggggctgga
attactactggtgaggatgtttataaggcgttgaagcttggagctcatggaataggtgta
gcaagtgctgttatgaaggctaaagagcctgaaaaggttgttgaggactttattacaagt
gcattgagggcgatctcttcgtag

DBGET integrated database retrieval system