KEGG   Sulfolobus solfataricus P2: SSO2592Help
Entry
SSO2592           CDS       T00054                                 

Gene name
tpiA
Definition
(GenBank) Triosephosphate isomerase (tpiA)
  KO
K01803  triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
sso  Sulfolobus solfataricus P2
Pathway
sso00010  Glycolysis / Gluconeogenesis
sso00051  Fructose and mannose metabolism
sso00562  Inositol phosphate metabolism
sso01100  Metabolic pathways
sso01110  Biosynthesis of secondary metabolites
sso01120  Microbial metabolism in diverse environments
sso01130  Biosynthesis of antibiotics
sso01200  Carbon metabolism
sso01230  Biosynthesis of amino acids
Module
sso_M00002  Glycolysis, core module involving three-carbon compounds
sso_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:sso00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SSO2592 (tpiA)
   00051 Fructose and mannose metabolism
    SSO2592 (tpiA)
   00562 Inositol phosphate metabolism
    SSO2592 (tpiA)
Enzymes [BR:sso01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     SSO2592 (tpiA)
Exosome [BR:sso04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   SSO2592 (tpiA)
  Exosomal proteins of bladder cancer cells
   SSO2592 (tpiA)
  Exosomal proteins of melanoma cells
   SSO2592 (tpiA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TIM NMO FMN_dh ThiG His_biosynth DUF561 IGPS G3P_antiterm DHO_dh Glu_synthase IMPDH Trp_syntA
Motif
Other DBs
NCBI-ProteinID: AAK42716
UniProt: Q97VM8
Position
2358713..2359396
Genome map
AA seq 227 aa AA seqDB search
MKPPIIIINFKAYENSFGDKAVNLGKKIEKISKEYSVEIILSTPATMIYRMSQEVDLPIY
AEHVDPVPLGAFTGAILPEMVKDAGAKGTLINHSERRLRADEIDDVLKRTKKLGLKSILC
VDRYELVYPFSLLKPDAILIEPPELIGTGVSVSKAKPEVITRAVDEIRKSEGIYLIAGAG
ITTGEDVYKALKLGAHGIGVASAVMKAKEPEKVVEDFITSALRAISS
NT seq 684 nt NT seq  +upstreamnt  +downstreamnt
gtgaaacctcctattattataataaactttaaggcatacgagaactcgtttggtgataaa
gcagtaaatttaggtaaaaaaatagaaaaaataagtaaagagtactcagttgaaatcata
ttgtcaacaccagccaccatgatatatagaatgtctcaggaagtagatttaccaatttat
gctgaacatgtagacccagtacctttaggagcatttactggagcgatattaccagaaatg
gtaaaagatgcaggtgctaagggtactttaataaatcacagtgagagacgtctaagagct
gatgaaatagatgatgtgctaaaaaggaccaaaaaattaggtttaaagagtatattatgt
gttgacagatatgaattggtatatccctttagtttgctgaaacctgacgcaattttaata
gagcccccagaattgataggaactggtgtctcagtttcgaaggctaaacctgaggtaata
actagagctgtagatgagataagaaagtccgagggaatatatctaatagcaggggctgga
attactactggtgaggatgtttataaggcgttgaagcttggagctcatggaataggtgta
gcaagtgctgttatgaaggctaaagagcctgaaaaggttgttgaggactttattacaagt
gcattgagggcgatctcttcgtag

DBGET integrated database retrieval system