KEGG   Sulfolobus solfataricus P2: SSO2599Help
Entry
SSO2599           CDS       T00054                                 

Gene name
pcm
Definition
(GenBank) L-isoaspartyl protein carboxyl methyltransferase (pcm)
  KO
K00573  protein-L-isoaspartate(D-aspartate) O-methyltransferase [EC:2.1.1.77]
Organism
sso  Sulfolobus solfataricus P2
Brite
Enzymes [BR:sso01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.77  protein-L-isoaspartate(D-aspartate) O-methyltransferase
     SSO2599 (pcm)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PCMT RrnaAD Methyltransf_25 Methyltransf_31 MTS Methyltransf_4 Met_10 Methyltransf_3 DOT1 CMAS
Motif
Other DBs
NCBI-ProteinID: AAK42721
UniProt: Q97VM3
Position
2363401..2364111
Genome map
AA seq 236 aa AA seqDB search
MSAKDDILRSIKNSKLANAFIKVNREDFLPQLLKKYAYDPNYVDKPFYITPNVTTTALSL
GMYMLDILNLGETQKVLEIGTGIGYYTALMAEVVGDNNVISLEIDDTIFEYAKNILLPKY
PRIKLIKTDGSLGYDKEAPYDRIIIWAAAPTVPCKLYDQLRENGIMVVPIGSEKAQGLYR
ITKIGYEPKIERLGDVIFMKMRGLFGFYEDDDPNERRIKKIEEKVNRLLSKFMSQS
NT seq 711 nt NT seq  +upstreamnt  +downstreamnt
atgagtgcaaaagacgacatattaaggtccataaagaattcaaaattagcaaatgcgttt
ataaaggttaatagggaggattttttgccacaattactgaaaaaatatgcatatgatcct
aattatgtagacaagcccttttacataacgcctaatgtgacgacaactgcattaagttta
ggcatgtatatgctcgatattcttaatttgggagaaactcagaaagttttagagataggt
acgggcataggttattatactgcgttaatggctgaagttgttggcgataataacgttatc
tcattagaaattgatgatacgatatttgaatacgctaaaaatattcttctgccgaaatat
ccgcgaatcaaattaattaagactgatggaagtctaggatatgataaggaggctccttat
gataggatcataatatgggcagctgcgccaacagtcccttgtaaactgtacgatcaactt
agggagaacggtattatggtagtaccgataggtagtgaaaaagcgcaaggtctctataga
attactaaaattggatatgaacctaagatagaaagacttggagatgtaatatttatgaaa
atgagaggattatttggattttatgaggatgacgatccgaatgagaggagaataaagaaa
atagaggagaaggttaatagattactgtcaaaatttatgagccagagctag

DBGET integrated database retrieval system