KEGG   Sulfolobus solfataricus P2: SSO2756Help
Entry
SSO2756           CDS       T00054                                 

Gene name
porB-2
Definition
(GenBank) Pyruvate synthase beta chain (Pyruvic-ferredoxin oxidoreductase beta chain) (porB-2)
  KO
K00170  pyruvate ferredoxin oxidoreductase beta subunit [EC:1.2.7.1]
Organism
sso  Sulfolobus solfataricus P2
Pathway
sso00010  Glycolysis / Gluconeogenesis
sso00020  Citrate cycle (TCA cycle)
sso00620  Pyruvate metabolism
sso00640  Propanoate metabolism
sso00650  Butanoate metabolism
sso00680  Methane metabolism
sso00720  Carbon fixation pathways in prokaryotes
sso01100  Metabolic pathways
sso01120  Microbial metabolism in diverse environments
sso01130  Biosynthesis of antibiotics
sso01200  Carbon metabolism
Module
sso_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:sso00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SSO2756 (porB-2)
   00020 Citrate cycle (TCA cycle)
    SSO2756 (porB-2)
   00620 Pyruvate metabolism
    SSO2756 (porB-2)
   00640 Propanoate metabolism
    SSO2756 (porB-2)
   00650 Butanoate metabolism
    SSO2756 (porB-2)
  Energy metabolism
   00720 Carbon fixation pathways in prokaryotes
    SSO2756 (porB-2)
   00680 Methane metabolism
    SSO2756 (porB-2)
  Xenobiotics biodegradation and metabolism
   00633 Nitrotoluene degradation
    SSO2756 (porB-2)
Enzymes [BR:sso01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.1  pyruvate synthase
     SSO2756 (porB-2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TPP_enzyme_C E1_dh DXP_synthase_N
Motif
Other DBs
NCBI-ProteinID: AAK42866
UniProt: Q97V79
Position
complement(2511689..2512588)
Genome map
AA seq 299 aa AA seqDB search
MSLGLREILNKHNGILSGTSACPGCPENMAMRMLGMGLGKDVVLVVVAGCSSVIQGNAPY
NAYNFPTVNVAFAAGPATAAGLARAYKQKGKNVTIVVWAGDGGSADIGFASLSGAAERND
NILYLTVDNEAYMNSGGQRSGSTPFGAITTTTPEGKKENKKNLPLLMIAHNVPYVATASV
GYPHDYIEKLKKARQVEGFRYVHVLTPDPYGWLFDPSKTVEVAKLAVQTCYWPLFEYYNG
KLNISSESLHCLDRRTRRPIRDFLSIQGRFKKLTDEQIKILEQYIDNLWEKLKSMLNNP
NT seq 900 nt NT seq  +upstreamnt  +downstreamnt
ttgagcttaggactccgagagatattgaataagcataacggtatcttatcaggaacttct
gcttgtcctggttgtccagaaaatatggcaatgagaatgctaggaatgggattaggtaaa
gatgtagttctagtagtagttgctggatgttcctcggtaatacaaggaaatgcgccttat
aatgcttacaacttccctacagttaacgttgcttttgcagctggtccagctacagcagct
ggtttggctagggcgtataaacaaaaaggtaaaaacgtcactatagtggtttgggctgga
gatggaggaagtgctgatataggattcgcctcactaagtggtgctgctgagagaaatgac
aatatactctaccttactgtggacaacgaggcatatatgaatagtggagggcagagaagt
ggatcaactccgtttggtgcaataaccacaacaactccagagggaaaaaaggaaaataag
aaaaatctaccactattgatgatagcgcataatgtaccctatgtggctactgcatctgta
ggatatccgcatgattatatagagaagttaaaaaaggctaggcaagtcgaaggttttaga
tacgttcatgttttaactccagacccttatggttggctatttgatccttcaaagaccgtt
gaggttgcaaaattagcagtgcaaacttgctactggcctctatttgagtattataatgga
aagttaaacattagttcagaaagtttacattgtcttgataggaggactagaagacctata
agagactttctaagcatacaaggaagatttaagaaattaactgatgagcaaataaaaatt
ttagaacaatatatagacaacttgtgggaaaagctaaaatccatgctcaataatccctaa

DBGET integrated database retrieval system