KEGG   Sulfolobus solfataricus P2: SSO3019Help
Entry
SSO3019           CDS       T00054                                 

Gene name
lacS
Definition
Beta-glycosidase (LACS) (EC:3.2.1.23)
Orthology
K01190  
beta-galactosidase [EC:3.2.1.23]
Organism
sso  Sulfolobus solfataricus P2
Pathway
Galactose metabolism
Other glycan degradation
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:sso00052]
Metabolism; Lipid metabolism; Sphingolipid metabolism
Metabolism; Glycan biosynthesis and metabolism; Other glycan degradation [PATH:sso00511]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Structure
PDB: 

Jmol
Position
2766637..2768106
Genome map
AA seq 489 aa AA seqDB search
MYSFPNSFRFGWSQAGFQSEMGTPGSEDPNTDWYKWVHDPENMAAGLVSGDLPENGPGYW
GNYKTFHDNAQKMGLKIARLNVEWSRIFPNPLPRPQNFDESKQDVTEVEINENELKRLDE
YANKDALNHYREIFKDLKSRGLYFILNMYHWPLPLWLHDPIRVRRGDFTGPSGWLSTRTV
YEFARFSAYIAWKFDDLVDEYSTMNEPNVVGGLGYVGVKSGFPPGYLSFELSRRAMYNII
QAHARAYDGIKSVSKKPVGIIYANSSFQPLTDKDMEAVEMAENDNRWWFFDAIIRGEITR
GNEKIVRDDLKGRLDWIGVNYYTRTVVKRTEKGYVSLGGYGHGCERNSVSLAGLPTSDFG
WEFFPEGLYDVLTKYWNRYHLYMYVTENGIADDADYQRPYYLVSHVYQVHRAINSGADVR
GYLHWSLADNYEWASGFSMRFGLLKVDYNTKRLYWRPSALVYREIATNGAITDEIEHLNS
VPPVKPLRH
NT seq 1470 nt NT seq  +upstreamnt  +downstreamnt
atgtactcatttccaaatagctttaggtttggttggtcccaggccggatttcaatcagaa
atgggaacaccagggtcagaagatccaaatactgactggtataaatgggttcatgatcca
gaaaacatggcagcgggattagtaagtggagatctaccagaaaatgggccaggctactgg
ggaaactataagacatttcacgataatgcacaaaaaatgggattaaaaatagctagacta
aatgtggaatggtctaggatatttcctaatccattaccaaggccacaaaactttgatgaa
tcaaaacaagatgtgacagaggttgagataaacgaaaacgagttaaagagacttgacgag
tacgctaataaagacgcattaaaccattacagggaaatattcaaggatcttaaaagtaga
ggactttactttatactaaacatgtatcattggccattacctctatggttacacgaccca
ataagagtaagaagaggagattttactggaccaagtggttggctaagtactagaacagtt
tacgaattcgctagattctcagcttatatagcttggaaattcgatgatctagtggatgag
tactcaacaatgaatgaacctaacgttgttggaggtttaggatacgttggtgttaagtcc
ggttttcccccaggatacctaagctttgaactttcccgtagggcaatgtataacatcatt
caagctcacgcaagagcgtatgatgggataaagagtgtttctaaaaaaccagttggaatt
atttacgctaatagctcattccagccgttaacggataaagatatggaagcggtagagatg
gctgaaaatgataatagatggtggttctttgatgctataataagaggtgagatcaccaga
ggaaacgagaagattgtaagagatgacctaaagggtagattggattggattggagttaat
tattacactaggactgttgtgaagaggactgaaaagggatacgttagcttaggaggttac
ggtcacggatgtgagaggaattctgtaagtttagcgggattaccaaccagcgacttcggc
tgggagttcttcccagaaggtttatatgacgttttgacgaaatactggaatagatatcat
ctctatatgtacgttactgaaaatggtattgcggatgatgccgattatcaaaggccctat
tatttagtatctcacgtttatcaagttcatagagcaataaatagtggtgcagatgttaga
gggtatttacattggtctctagctgataattacgaatgggcttcaggattctctatgagg
tttggtctgttaaaggtcgattacaacactaagagactatactggagaccctcagcacta
gtatatagggaaatcgccacaaatggcgcaataactgatgaaatagagcacttaaatagc
gtacctccagtaaagccattaaggcactaa

DBGET integrated database retrieval system