KEGG   Sulfolobus solfataricus P2: SSO7412Help
Entry
SSO7412           CDS       T00054                                 

Gene name
porD-1
Definition
pyruvate synthase subunit delta (EC:1.2.7.1)
Orthology
K00171  
pyruvate ferredoxin oxidoreductase, delta subunit [EC:1.2.7.1]
Organism
sso  Sulfolobus solfataricus P2
Pathway
Glycolysis / Gluconeogenesis
Citrate cycle (TCA cycle)
Pyruvate metabolism
Nitrotoluene degradation
Propanoate metabolism
Butanoate metabolism
Methane metabolism
Carbon fixation pathways in prokaryotes
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
Pyruvate oxidation, pyruvate => acetyl-CoA
Dicarboxylate-hydroxybutyrate cycle
Brite
KEGG Orthology (KO) [BR:sso00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    SSO7412 (porD-1)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SSO7412 (porD-1)
   00020 Citrate cycle (TCA cycle)
    SSO7412 (porD-1)
   00620 Pyruvate metabolism
    SSO7412 (porD-1)
   00640 Propanoate metabolism
    SSO7412 (porD-1)
   00650 Butanoate metabolism
    SSO7412 (porD-1)
  Energy metabolism
   00720 Carbon fixation pathways in prokaryotes
    SSO7412 (porD-1)
   00680 Methane metabolism
    SSO7412 (porD-1)
  Xenobiotics biodegradation and metabolism
   00633 Nitrotoluene degradation
    SSO7412 (porD-1)
Enzymes [BR:sso01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.1  pyruvate synthase
     SSO7412 (porD-1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1046762..1047028)
Genome map
AA seq 88 aa AA seqDB search
MIKVPIGVPVARPKIGSAGKTGLWRVEKPVISYDKCTKCRLCVLYCLENTIDLLENLYPQ
IDYDYCKGCGVCAQVCPPKAIDMVREVK
NT seq 267 nt NT seq  +upstreamnt  +downstreamnt
ttgattaaagttccaataggagttccagttgcaaggccaaagataggttcagctggaaaa
accggattatggagagtagagaaaccagtgattagttacgataaatgtactaaatgcaga
ctttgcgtactttattgtctggaaaataccattgatctcctagagaacctatatcctcaa
attgattatgattactgcaaaggttgtggcgtttgtgcacaagtttgcccacctaaggct
atagatatggttagggaggtgaaataa

DBGET integrated database retrieval system