KEGG   Staphylococcus saprophyticus: SSP0059Help
Entry
SSP0059           CDS       T00269                                 

Definition
(GenBank) UTP-glucose-1-phosphate uridyltransferase
  KO
K00963  UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
ssp  Staphylococcus saprophyticus
Pathway
ssp00040  Pentose and glucuronate interconversions
ssp00052  Galactose metabolism
ssp00500  Starch and sucrose metabolism
ssp00520  Amino sugar and nucleotide sugar metabolism
ssp01100  Metabolic pathways
ssp01130  Biosynthesis of antibiotics
Module
ssp_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:ssp00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    SSP0059
   00052 Galactose metabolism
    SSP0059
   00500 Starch and sucrose metabolism
    SSP0059
   00520 Amino sugar and nucleotide sugar metabolism
    SSP0059
Enzymes [BR:ssp01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     SSP0059
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NTP_transferase NTP_transf_3 IspD CTP_transf_3
Motif
Other DBs
NCBI-ProteinID: BAE17204
UniProt: Q4A122
Position
69784..70647
Genome map
AA seq 287 aa AA seqDB search
MKIKKAIIPAAGLGTRFLPATKAMPKEMLPILDKPTIQYIVEEAVAAGIEDIIIVTGKHK
RAIEDHFDNQKELEMILEEKGKSDLLQSVKYSSNLANMFYVRQKEQKGLGHAIWTARQFI
GNEPFAVLLGDDIVQADTPAIKQLMNQYETTGKSIIGVQQVNEIETHRYGIVDPEESYNE
LFSVNKFVEKPEIGTAPSNLAIMGRYVLKPDIFDYLERQEIGRGGEIQLTDAIEHLNSED
CVYAYNFEGERYDVGEKIGFVKTTIQFALKDDYMKKEITEFIKSINK
NT seq 864 nt NT seq  +upstreamnt  +downstreamnt
atgaaaattaaaaaggcaataataccagcggcggggctaggtacaagatttttaccagca
actaaggcgatgcctaaagaaatgttacctattttagataaacctactatccaatatata
gtagaagaagcagtagcagcgggaattgaagatattattatagttacaggcaagcataaa
agagcaatcgaagatcattttgacaatcaaaaagaattggaaatgattctggaagaaaaa
ggtaaatctgatttacttcaatcagtaaaatactcaagcaacttagcaaatatgttttat
gtaagacaaaaagaacaaaaaggtttaggtcatgctatatggaccgctagacaatttata
gggaatgaaccttttgctgttttattaggagatgacattgtacaagcagatactccagcc
ataaaacaattgatgaaccagtatgaaacgacaggtaaatcaattataggagtacaacaa
gtaaatgaaattgaaacacatagatacggtattgttgatcctgaagaatcgtacaatgag
ttgtttagtgtaaataaatttgtagaaaaaccagaaattgggactgccccttccaattta
gctataatgggacgctacgtactaaaaccagatatatttgattatttagagcgtcaagaa
attggcagaggtggcgaaatacaattaacagatgcaattgaacatttaaattctgaagat
tgtgtatacgcttataattttgaaggtgaacgttatgatgtaggtgaaaaaataggtttt
gttaaaaccacaatacaatttgctttaaaagatgattatatgaaaaaagaaattacagaa
tttattaaatccataaataaataa

DBGET integrated database retrieval system