KEGG   Staphylococcus saprophyticus: SSP0105Help
Entry
SSP0105           CDS       T00269                                 

Definition
beta-D-galactosidase
Orthology
K01190  
beta-galactosidase [EC:3.2.1.23]
Organism
ssp  Staphylococcus saprophyticus
Pathway
Galactose metabolism
Other glycan degradation
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ssp00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    SSP0105
  Lipid metabolism
   00600 Sphingolipid metabolism
    SSP0105
  Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    SSP0105
Enzymes [BR:ssp01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.23  beta-galactosidase
     SSP0105
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
120502..123480
Genome map
AA seq 992 aa AA seqDB search
MFKEKFHEDLEKQNVNLLPRRAFYIPYQLGEKDYDFKTRYETQNITLLNGKWQFEFFNSL
EDYTNEDINSKEQYLTVPSVWNLYGFDQIQYLNTQYPIPFNPPYVPRENPCGRYKRSFEI
NDYNEQSDYHLNFEGVDSAFYIWINEQFVGYSQIAHSISEFDITPYVQKGINSIEVIVLK
YSDGTYFENQDMFRHSGIFRDVYILKRSKSRVDDFKIETTINHESNNGKINFTLQGKHHL
GNINLVLYNPKGLEIDRAIVSKHHQFVIDNPQLWSSENPVLYKIIIETENEVITQKIGIR
EVKIQDNQFYINGKSIKIRGVNYHDSHPQNGFVMYERDFEKDLKLMKQGNFNAIRTAHYP
KAPLFYEMTDQYGFYVMSEADLETHGVVRLYGEENTEHFNIIADNPKFETSIIERIEASI
KPLKNYSSIVSWSIGNESGFGINMVKGLERAKQLDTTRPLHYEGALYRDKEKNYDMSNVD
MISRMYASPEEILETYLENPKLDKPFILCEYAHAMGNSPGDLNAYQTLIEKYDSFIGGFV
WEWCDHSIQVGIKEGKPIFRYGGDFGEALHDGNFCVDGIVSPDRIPHEGYYEFKHEHRPL
RLVNEEDYRFTLKNQFDFTNAEDSLIVEGEAIYLDGERKVFNIPLTAFAPHISQTFDLRD
YVTLDNISSLMLRYKLKEEESYRDKYFEVGHDQIIYQRRALPYLNEEKMEFQCKDMEHSI
NISVGNKYAYSFDKKQGCLKSVLHNNEIIFNNNTETKIWRAPIDNDAYIKKEWLYSGYNN
IQTLVTNYKIIEDESNISLVFEINIESEAVPPVLKGSLTWTVYQDGKVNVDYNLEKDNNA
PFLPRFGLLITLPSTYEQINYYGNGPMSSYQDKGIATYLDMFETTVTNNGDVHIKPQEAG
SHNQTTIMNITNNEHTLTITSEDTFSFNASHYSLNQLTEAKHVDELEIENNTYLYVDYAQ
SGIGSNSCGPELNEEYRLNNKKITFNFDLNIY
NT seq 2979 nt NT seq  +upstreamnt  +downstreamnt
atgtttaaagaaaaatttcatgaagatttagaaaaacaaaatgtgaatttgttgcctaga
agagctttttatataccatatcagcttggagaaaaagattatgatttcaaaacgagatat
gaaactcaaaatatcacattacttaatggtaaatggcaatttgaattttttaattcattg
gaagactatacaaatgaagatattaatagcaaagagcaatatttaacagtaccatctgta
tggaatttgtatgggtttgatcagattcagtatttaaatacacaataccctataccgttt
aatccaccatacgtgcctagagaaaatccatgtggtcgatataaacgttcatttgaaata
aatgactataatgaacaaagcgattatcatttgaactttgaaggtgtcgatagtgcattc
tatatctggatcaatgaacagtttgtaggatatagtcaaattgcacattcaatttcagag
tttgatattacaccatatgttcaaaaaggaataaattcaattgaagtcattgtacttaag
tactctgatggaacatattttgaaaatcaagacatgtttcgtcattcaggtatttttaga
gatgtatatatattaaaaagatctaaatcgcgcgtggacgactttaaaattgagacaaca
ataaaccatgaatctaataatggaaaaataaatttcactttacaaggaaagcatcattta
gggaatattaacttggttttatataatcctaaagggctagaaatagatcgcgcaattgtt
tcaaagcatcatcaatttgtaatagataatccacaattatggtcatctgagaatccagta
ctttataagataattattgaaacagaaaacgaagtaatcactcagaaaattggaataaga
gaagttaaaatacaagataatcaattctatattaatggaaaatcaattaaaatacgggga
gtaaattaccatgatagccatcctcaaaatggttttgtcatgtatgaaagagattttgaa
aaagatttaaaattaatgaaacaaggcaattttaatgcgattcgtactgcgcattatccg
aaggcaccattattttatgaaatgactgaccaatatggtttctatgtaatgagtgaggca
gatttagaaactcatggtgtagtaaggttatatggagaagaaaatacagaacactttaat
attattgctgataatccaaaatttgaaacatctattattgaaagaatagaagcctctatc
aagccattaaaaaactatagttctattgtttcttggtcaataggtaatgaatctggattt
ggcatcaatatggttaaaggattggaacgggcaaagcaattagacacgacaagaccatta
cattatgaaggtgcattgtatcgagataaagaaaaaaattatgatatgtccaatgttgat
atgataagtagaatgtatgcttctccagaagaaattttagaaacatatctagaaaatccc
aaattagataaaccgtttatattatgtgaatacgcacatgcaatgggaaattcaccagga
gatcttaatgcatatcaaacattaattgaaaaatatgatagttttattggcggttttgtt
tgggaatggtgtgatcatagcattcaggttgggataaaggaaggtaaaccaatttttaga
tatggtggagattttggtgaggccttacatgacggtaatttttgtgttgatggtattgtt
tcgccagatcgaattccacatgaaggttattatgagtttaaacatgaacatagacctttg
agattggttaacgaagaggattatcggtttacattgaagaatcaatttgattttacaaat
gcggaggatagtttgattgttgagggagaagctatttatttagatggtgagagaaaggtg
tttaatattccattaactgctttcgcgcctcatataagccaaacttttgatttaagagat
tatgtaacgcttgataatataagtagtttgatgcttcgttataaattaaaagaagaagaa
agctatagagataagtattttgaggttggacatgatcaaattatttatcaacgtcgagca
ttaccatatctcaatgaagaaaaaatggagtttcaatgcaaagatatggaacattcgatt
aatatttcggtaggcaacaaatatgcatatagttttgacaagaaacaaggatgcttaaaa
tcagtgcttcacaataatgaaatcattttcaataacaataccgaaactaaaatttggcgt
gccccgatagataatgatgcatatattaaaaaagagtggttatattctggttataataac
attcaaacacttgtgacaaattataaaataattgaagatgagtctaatatcagtctcgtt
tttgaaattaatatagagtcagaagccgtgccgccagttttgaaaggatcacttacttgg
acggtttatcaagatggaaaagtaaatgtagattataacttagaaaaagataacaacgca
ccatttttaccaagatttggtttactaataactttaccttcaacatatgaacaaataaat
tactatggaaatggtccaatgagtagctatcaagataaagggatagcaacatacttagac
atgtttgaaacaacggtgacaaataatggtgatgtgcatattaaacctcaagaagctggt
agtcataatcaaacaacaattatgaatattaccaacaatgagcatacgcttactatcact
agtgaagatacattcagctttaacgcatcacattattctttaaatcaattaacagaggca
aaacatgtggatgaattggaaatagaaaataacacatatttatatgtcgattatgcacaa
agcggtataggttcaaatagttgtggtcctgaattaaatgaggaatatcgattaaacaat
aaaaagataacgttcaattttgatttgaatatttattag

DBGET integrated database retrieval system