KEGG   Staphylococcus saprophyticus: SSP0126Help
Entry
SSP0126           CDS       T00269                                 

Definition
(GenBank) putative arginase
  KO
K01476  arginase [EC:3.5.3.1]
Organism
ssp  Staphylococcus saprophyticus
Pathway
ssp00220  Arginine biosynthesis
ssp00330  Arginine and proline metabolism
ssp01100  Metabolic pathways
ssp01110  Biosynthesis of secondary metabolites
ssp01130  Biosynthesis of antibiotics
ssp01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:ssp00001]
 Metabolism
  Amino acid metabolism
   00220 Arginine biosynthesis
    SSP0126
   00330 Arginine and proline metabolism
    SSP0126
Enzymes [BR:ssp01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.1  arginase
     SSP0126
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Arginase
Motif
Other DBs
NCBI-ProteinID: BAE17271
UniProt: Q4A0W7
Position
144396..145187
Genome map
AA seq 263 aa AA seqDB search
MGAHLLNWLIPNDSNQEAFEIKVEEPDEDALELENGVYGQSQIINNVKQAQDILNQEQPD
KVVTLGGNCMVSQAPFDYLNQKYGDELGIVWIDTHPDISYPKDITNEHAMVVANLLGEGD
SELSKLVKAPLKTNQFLHVGLQELLDFEAENLEKLNFDYKVQGTESYNYEEIQQWIKENN
FSKIAIHFDIDVLDPNEFRATYFAEPHIESFPAAAGQMSLSHLNDILKGISENNDIVGFT
VAEYMPWDEINLKNTLKDLNIFH
NT seq 792 nt NT seq  +upstreamnt  +downstreamnt
atgggggcacacttattaaactggttaattcctaatgattctaaccaagaagcttttgag
attaaagtcgaagaaccagatgaagacgcattagaattagaaaatggtgtatacgggcag
tctcaaataataaataatgtaaagcaagcacaagatattttaaatcaagaacaaccagat
aaagtagttactttaggcggcaattgtatggtctcacaagcaccttttgattatttaaat
caaaaatatggtgatgaactcggtattgtttggattgatacacatccagatatttcatat
cctaaagacattacaaatgaacacgccatggttgtagctaatttacttggtgaaggcgat
agtgaattgtcgaaattggttaaagcaccattaaaaactaatcaatttttacacgtaggt
ttacaagaattattagattttgaagcggaaaatctagaaaaattaaattttgattataaa
gtacaaggcacagaaagttataattatgaagaaatacaacaatggattaaggaaaataac
ttttcgaaaatagccatccattttgatattgatgtcttggatccaaatgagtttcgtgcc
acttactttgcggaacctcatattgaatcgttcccagcagcagctggacaaatgtccttg
tcgcatttaaatgacatactaaaaggcatttcagaaaataatgatattgtaggctttact
gtagcagagtacatgccatgggatgaaatcaatctgaaaaatacattgaaagatttgaat
atattccattaa

DBGET integrated database retrieval system