KEGG   Staphylococcus saprophyticus: SSP0429Help
Entry
SSP0429           CDS       T00269                                 

Definition
histidinol dehydrogenase
Orthology
K00013  
histidinol dehydrogenase [EC:1.1.1.23]
Organism
ssp  Staphylococcus saprophyticus
Pathway
Histidine metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:ssp00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    SSP0429
  Amino acid metabolism
   00340 Histidine metabolism
    SSP0429
Enzymes [BR:ssp01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.23  histidinol dehydrogenase
     SSP0429
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(463908..465179)
Genome map
AA seq 423 aa AA seqDB search
MIIDKTLFLKKYLNQSSLNEDLYPIVKDICENVRLHGDDALRNYNQQFDQVETCNLEVAY
QTLENAYNRLDSDLREALQQSHARIQSYQESIKWTKQQGTSDCYELYHPLERVGVYVPGG
KASYPSTVLMTVTLAKVAGVKNISVVTPPQLNGIPDIVLAACYIAGVDNVYQVGGAQSIA
ALAYGTETLPKVDKIVGPGNQFVAYAKKYLFGQVGIDQIAGPSEIALIIDDSADLDAIAY
DVFAQAEHDELARTFVISEDEALLKQLEQKIQHILPQIERQSIVQASLNDNHFLIHVNNF
SEACDLMNQIAPEHASIQTVSPHDYLNHVRYVGALFLGYYSPEVIGDYVAGPSHVLPTNQ
TARFTNGLSVNDFLTRHSVIDLSKDTFDTVELTARKLAHVEQLYNHEQSIEIRTSKEFND
DKN
NT seq 1272 nt NT seq  +upstreamnt  +downstreamnt
ttgatcatagataaaacgctatttttgaaaaagtatttaaaccaatcttccttaaatgaa
gacctataccccatcgtaaaggatatttgcgaaaacgtcagacttcacggagatgatgcc
ctcagaaattataatcaacagtttgatcaggtagagacttgcaatttagaagtcgcttac
caaactttagaaaatgcctataatcgcctagacagtgatttacgtgaggccttacaacaa
agtcacgcgcgtattcaatcttaccaagaatccattaaatggactaagcaacaaggcaca
tcagattgttatgaattgtaccatcctttagaacgcgttggcgtatatgtaccaggtggt
aaagccagttacccatcaaccgtcttaatgacagtaacactggcaaaggtagctggtgta
aaaaatatatctgtagtcacgcccccacaactaaatggtataccagatatcgtattagcc
gcctgttatatcgcaggtgtcgataacgtttatcaagttggaggtgctcaaagtattgct
gccctagcttacggtacagaaacattgccaaaagttgataaaattgtaggacctggtaac
caatttgttgcctatgctaagaaatacctctttggtcaagtaggaattgatcaaatcgcg
ggccctagtgaaattgcattaattattgatgactctgctgatttagacgccatcgcatat
gatgtatttgcacaagcagagcacgatgaacttgcaagaacttttgtcattagtgaagat
gaagcattattaaaacaacttgaacaaaaaatacagcacatacttcctcaaattgaacgt
caatcaatcgttcaagcaagtttaaatgataaccattttttgatacatgtgaataacttt
agcgaagcgtgtgatttaatgaatcaaattgcacccgaacatgcttcaatacaaacagtt
tcgccacatgattatctaaatcatgtccgttacgtcggcgcactattcttaggttattat
tcacccgaagttattggtgactatgtcgctggcccaagtcacgtactgccaaccaatcaa
acagctcgatttaccaatggtctatctgttaatgattttttaacacgtcattcagtgata
gatttatcaaaagatacattcgataccgtagaactgactgcgcgtaaattagcccatgtt
gaacaattatataatcacgaacaatccatagaaattagaacatcaaaggagtttaacgat
gataagaattaa

DBGET integrated database retrieval system