KEGG   Staphylococcus saprophyticus: SSP0483Help
Entry
SSP0483           CDS       T00269                                 

Gene name
gpmA
Definition
phosphoglyceromutase
Orthology
K01834  
2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
ssp  Staphylococcus saprophyticus
Pathway
Glycolysis / Gluconeogenesis
Glycine, serine and threonine metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:ssp00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    SSP0483 (gpmA)
   01230 Biosynthesis of amino acids
    SSP0483 (gpmA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SSP0483 (gpmA)
  Energy metabolism
   00680 Methane metabolism
    SSP0483 (gpmA)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    SSP0483 (gpmA)
Enzymes [BR:ssp01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     SSP0483 (gpmA)
Exosome [BR:ssp04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   SSP0483 (gpmA)
  Exosomal proteins of melanoma cells
   SSP0483 (gpmA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
518971..519657
Genome map
AA seq 228 aa AA seqDB search
MPKLILCRHGQSVWNAENLFTGWADVDLSEQGENEAITSGKKLKAQGIEIDIVYTSLLER
AIKTTYHLLNESNQLFIPIIKSWRLNERHYGGLQGLNKDDARKKFGEDQVHIWRRSYDVA
PPKQDEAQRESYLNDRKYEHLDRRVMPESESLKDTLVRVIPYWNDQISQQLLDGKTVLVS
AHGNSLRALIKYLENVSDEDIVGYEIKTGAPLIYELTDDLQVIDKYYL
NT seq 687 nt NT seq  +upstreamnt  +downstreamnt
atgccaaaattaattttatgtagacatggacaaagtgtgtggaatgcagaaaacctattt
acaggatgggcagatgttgatctatcagaacagggcgaaaatgaagccataacatctggt
aaaaaattaaaagcacaaggcattgaaatcgatatagtttatacatctttactcgaacgt
gcgattaaaacaacttatcacttattaaatgaatctaatcaattatttattcctataatt
aaatcttggagattaaatgaaagacattatggtggtttacaaggactaaataaagatgat
gcacgtaaaaagtttggtgaagatcaagtacatatttggagacgttcatatgatgttgca
ccgccaaaacaagatgaagcacaacgagaaagttatttaaatgaccgtaaatatgaacat
ttggatagacgtgtcatgcctgaatctgaaagcctaaaagatacgttagtaagagtgata
ccgtattggaacgatcaaatttctcaacaacttttagatggtaaaacagtgttagtatca
gctcatggtaattcattacgtgcattgattaagtatttagagaatgtttctgatgaagat
atcgttggatatgaaattaaaacaggtgcaccattaatatatgaacttacagatgactta
caagttatagacaaatattacttataa

DBGET integrated database retrieval system