KEGG   Staphylococcus saprophyticus: SSP0566Help
Entry
SSP0566           CDS       T00269                                 

Definition
(GenBank) putative aldose 1-epimerase
  KO
K01785  aldose 1-epimerase [EC:5.1.3.3]
Organism
ssp  Staphylococcus saprophyticus
Pathway
ssp00010  Glycolysis / Gluconeogenesis
ssp00052  Galactose metabolism
ssp01100  Metabolic pathways
ssp01110  Biosynthesis of secondary metabolites
ssp01120  Microbial metabolism in diverse environments
ssp01130  Biosynthesis of antibiotics
Module
ssp_M00632  Galactose degradation, Leloir pathway, galactose => alpha-D-glucose-1P
Brite
KEGG Orthology (KO) [BR:ssp00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SSP0566
   00052 Galactose metabolism
    SSP0566
Enzymes [BR:ssp01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.3  aldose 1-epimerase
     SSP0566
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldose_epim
Motif
Other DBs
NCBI-ProteinID: BAE17711
UniProt: Q49ZR3
Position
602852..603871
Genome map
AA seq 339 aa AA seqDB search
MMFAKVESQSNGIDLIKIDNEETKIVFTNYGARIVSWKYDDNNIVLGNVVEADEFYESNP
YNFGATVGRYGGRIANATFELDSKKYELDANNGVHNIHGGPNGIDKRFFDYKIEEQVGQV
KVIFTTTIQSADDHFPGDIDLEVIHTYNVDHKWTIEYKAKSTEKTLFNPMNHVYFNLNRD
NNVIDNHSISSSKLDMYLLGEDNIVKSMEPLSLVNTFQEQNIQFKDIFDSEDAIVKEQMQ
RFGGIDHPFDIGGNEMTVENKHFILKVNTDMPNIVIYTFNDTTGWNSDFNIYKAHSGFTL
ETQCIPNDINLLGDQAPSILEANEPFYSKTSYKISEKQL
NT seq 1020 nt NT seq  +upstreamnt  +downstreamnt
atgatgtttgcaaaagtagaaagtcaaagcaatggtatcgatttgattaaaattgataat
gaagaaacaaaaattgtttttacaaattatggtgcgagaattgtatcgtggaaatacgac
gataataatattgtactgggtaatgtcgttgaagcagatgagttttatgaatcgaatcct
tataattttggtgcaaccgtaggtcgatatggcggaagaattgcaaatgcaacatttgag
ttagatagtaaaaaatatgagttagatgccaataatggtgtacataatattcatggtgga
cccaatggtatagacaaacgtttctttgattataaaattgaagaacaagtcggacaagtg
aaggttatttttactactacaattcaaagtgcagatgatcactttccaggtgatattgat
ttagaagtgattcacacttataatgtcgaccataagtggacgatagaatataaagcgaaa
tcaactgaaaaaacattgtttaatccgatgaatcatgtatattttaacttgaacagagac
aacaatgtgattgataatcacagcatttcaagttcaaaattggatatgtatttattaggg
gaagacaatatcgtgaaaagtatggaacctttaagtttggtaaataccttccaagaacaa
aatatccagttcaaagatatttttgatagtgaagacgcaattgttaaagaacaaatgcaa
cgctttggtggtattgatcatccatttgatattggtggtaatgaaatgactgtggaaaat
aaacattttatattaaaagtaaacacagatatgccaaacattgtcatttacacatttaat
gatacaactggttggaatagtgattttaatatttataaagcgcactcaggttttacacta
gaaacgcaatgtattccaaacgatattaatttattaggcgatcaagcaccatccatttta
gaagctaatgagcctttttactctaaaacgtcatataaaatttctgaaaagcaactataa

DBGET integrated database retrieval system