KEGG   Staphylococcus saprophyticus: SSP0744Help
Entry
SSP0744           CDS       T00269                                 

Definition
ribokinase
Orthology
K00852  
ribokinase [EC:2.7.1.15]
Organism
ssp  Staphylococcus saprophyticus
Pathway
Pentose phosphate pathway
Brite
KEGG Orthology (KO) [BR:ssp00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    SSP0744
Enzymes [BR:ssp01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.15  ribokinase
     SSP0744
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
774479..775342
Genome map
AA seq 287 aa AA seqDB search
MGKIIVIGSASIDLVVKTDILPEAGETVMGTSFFTNPGGKGANQAVAAARLSNEVYMIGA
VGDDAYGKQILENLKDNHVDTTYMDIIDNEKSGTAHITLFEDDNRIIVVPAANNYITPDI
VLPKLENFGEDDIILLQHEILEATVQSVVTYAAKHGIKVILNPAPYRELDKEVIEKVTWI
TPNESESELLFDHQVEQALKAYPRKLIITQGAKGALFYSDTQQLIEGYKKEVIDTTGAGD
TFNGALAVALIENKSLEDAVNFANLAGSFSVTGLGAQGAMPYRKDLE
NT seq 864 nt NT seq  +upstreamnt  +downstreamnt
atgggaaaaattattgtaattggtagtgcatcaatagatttagttgtaaaaactgatata
ttgcccgaagcaggagaaacagtaatgggcacttcattttttactaatcctggtggcaaa
ggcgcaaatcaagcggtagcggctgcacgcttaagtaatgaagtgtatatgataggtgca
gtgggcgatgatgcatacggcaaacaaattttggaaaacttgaaagataatcatgttgat
accacttacatggacatcattgacaatgagaagtcaggtacagcacacattacattattt
gaagatgataatcgtattattgtcgttccggctgccaataactatattacaccagatatt
gttttgccaaagttggaaaactttggtgaagatgacattattttgctccaacatgaaatt
cttgaagcaacggttcaatcagttgtcacatatgcagcaaagcatggtatcaaagttatt
ttaaatcctgcgccttatcgtgaattggataaagaagtaatcgaaaaagtaacatggata
acgccgaacgaatcagaaagtgaattactatttgaccatcaagtagaacaagcacttaaa
gcatatccacgtaaacttattattacgcaaggcgcaaaaggcgcattgttttatagcgat
acgcaacaactgattgaaggttataaaaaggaagtcatagatacaacaggagctggagat
acttttaatggtgcactagcagttgcattaattgaaaataagtcattggaagatgctgtg
aattttgctaatttggctggtagtttttcagtgacaggtttaggtgcacaaggcgcaatg
ccgtatagaaaagacttggaataa

DBGET integrated database retrieval system