KEGG   Staphylococcus saprophyticus: SSP0749Help
Entry
SSP0749           CDS       T00269                                 

Definition
phosphopentomutase (EC:5.4.2.7)
Orthology
K01839  
phosphopentomutase [EC:5.4.2.7]
Organism
ssp  Staphylococcus saprophyticus
Pathway
Pentose phosphate pathway
Purine metabolism
Brite
KEGG Orthology (KO) [BR:ssp00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    SSP0749
  Nucleotide metabolism
   00230 Purine metabolism
    SSP0749
Enzymes [BR:ssp01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.7  phosphopentomutase
     SSP0749
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
779096..780283
Genome map
AA seq 395 aa AA seqDB search
MTTPFKRVHLIVMDSVGIGEGPDAKAFDDEGSHTLKHTLEGFEQSLPNLQKLGLGNIEPL
PVIDKEVEPQAFYTKMSEASVGKDTMTGHWEIMGLNIMQPFKVYPEGFPEELVNEIETLT
GRKVVANRPASGTQIIDEWGEHQMKTGDLIVYTSADPVLQIAAHEDIIPLEELYDICEKV
RELTKDPKYLIGRIIARPYIGEPGSFKRTSNRHDYALKPFGRTVMNELKDNGYDVIALGK
INDIFDGEGVTESIRTKDNMDGIDKLIETVQRDFNGLSFLNLVDFDALYGHRRDKPGYAQ
AIKDFDERLSELMNHLQEEDLVIITADHGNDPTADGTDHTREYIPVLMFSPKMTDYHELT
IDSTFSSLGATIADNFGVKLPEFGKSYLKEMGVEK
NT seq 1188 nt NT seq  +upstreamnt  +downstreamnt
atgactacaccatttaaacgagttcatttaattgtcatggactctgttggtattggagaa
ggacctgatgcaaaagcttttgatgatgaaggcagtcacactttaaagcatacgctcgaa
ggatttgaacagtcattacctaacttacaaaaattaggtttaggtaatattgaacctctt
ccggttattgataaagaagtggaaccacaagctttttacacaaaaatgagtgaagcttca
gtcggcaaagataccatgactggccattgggagattatggggctaaatatcatgcaacca
tttaaggtctatccagaaggctttccagaagaactggttaatgaaatcgaaacgttaaca
ggacgtaaagttgtagccaatcgtcctgcatccggtacgcaaatcatagatgaatggggc
gaacatcagatgaagacgggtgatctaattgtctatacttctgcagacccagtacttcaa
attgcagctcatgaagatattattcccttagaggaactatatgacatctgtgaaaaagta
agagaattaaccaaggatcctaaatatttaataggcagaatcattgctagaccttatatt
ggagagccaggttcatttaaacgaacttctaatagacatgactatgcattaaaaccattt
ggtagaacagtaatgaatgaattaaaagataatggttatgatgtcattgcccttggtaaa
attaatgatatatttgacggtgaaggtgtgactgaatcgatacgtaccaaagataacatg
gatggtattgataaattaattgaaactgtgcaacgtgactttaatgggttaagcttttta
aatcttgttgatttcgatgccctttatggccatcgtcgtgataaacctggatatgcacaa
gcgattaaagattttgatgaacgtttatctgaacttatgaatcacttacaagaagaagat
ttagttattattacagcagaccatggtaatgatccaactgcagatggtacggatcatact
agagaatacattcctgtacttatgtttagtcctaaaatgactgactatcatgagctaacg
atagacagcacatttagttctttaggtgcaacgattgctgataattttggtgtgaaatta
cctgaatttggcaaaagctatttgaaagaaatgggtgttgaaaagtaa

  All links  
No link information was found.   
DBGET integrated database retrieval system