KEGG   Staphylococcus saprophyticus: SSP0871Help
Entry
SSP0871           CDS       T00269                                 

Definition
(GenBank) aldehyde dehydrogenase
  KO
K00128  aldehyde dehydrogenase (NAD+) [EC:1.2.1.3]
Organism
ssp  Staphylococcus saprophyticus
Pathway
ssp00010  Glycolysis / Gluconeogenesis
ssp00053  Ascorbate and aldarate metabolism
ssp00071  Fatty acid degradation
ssp00280  Valine, leucine and isoleucine degradation
ssp00310  Lysine degradation
ssp00330  Arginine and proline metabolism
ssp00340  Histidine metabolism
ssp00380  Tryptophan metabolism
ssp00410  beta-Alanine metabolism
ssp00561  Glycerolipid metabolism
ssp00620  Pyruvate metabolism
ssp00625  Chloroalkane and chloroalkene degradation
ssp01100  Metabolic pathways
ssp01110  Biosynthesis of secondary metabolites
ssp01120  Microbial metabolism in diverse environments
ssp01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:ssp00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SSP0871
   00053 Ascorbate and aldarate metabolism
    SSP0871
   00620 Pyruvate metabolism
    SSP0871
  Lipid metabolism
   00071 Fatty acid degradation
    SSP0871
   00561 Glycerolipid metabolism
    SSP0871
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    SSP0871
   00310 Lysine degradation
    SSP0871
   00330 Arginine and proline metabolism
    SSP0871
   00340 Histidine metabolism
    SSP0871
   00380 Tryptophan metabolism
    SSP0871
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    SSP0871
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    SSP0871
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    SSP0871
Enzymes [BR:ssp01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.3  aldehyde dehydrogenase (NAD+)
     SSP0871
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh Spectrin
Motif
Other DBs
NCBI-ProteinID: BAE18016
UniProt: Q49YW4
Position
complement(897473..898852)
Genome map
AA seq 459 aa AA seqDB search
MNSIEQTFHNSKQYFNTHATKDLKFRKKQLKLLSKSIKNHEDALLNAFQEDLGKNKVEAY
ATEIGFTLKNIKTARKELKNWAKKKQVNTPLYMFPTKSYIVKEPYGTVLIIGPFNYPFQL
LIEPLIGAIAAGNTVIIKPSEFTPHVSAVVKNIIEDVFDPEYISICQGDADTTQSLIHLP
FDYIFFTGSERVGRIVYQAASTNLTPVTLELGGKSPVIVDETANIKVASERISFGKFTNA
GQTCVAPDYVLVNRKVKEDLIKALKNTITEFYGKEIQASPDFGRIVNQTHFDRLNDLLGV
HKSEIVFGGHSDSAENYIGPTLLDGITFNDKIMEGEIFGPILPIITYDDFDEAIDLIHTK
PKPLSLYLFSEDENATERVLNEISFGGGAINDTLMQLANPNLPFGGVGASGIGQYHGKFS
FDTFSHDKSYIFKSTRLESSLLFPPYKGKFKYIKTFFNK
NT seq 1380 nt NT seq  +upstreamnt  +downstreamnt
ttgaattcaatagaacaaactttccataatagtaaacaatattttaatacacatgcgacc
aaggatcttaaattcagaaaaaaacaactaaagctcctaagcaaaagtattaaaaatcat
gaagatgcattattaaatgcttttcaagaagatttaggtaaaaacaaagtagaagcctat
gcaacagaaatcggctttactttaaaaaatatcaaaacggctcgtaaagaattaaaaaac
tgggctaaaaagaaacaggttaatacaccgctttatatgtttcctaccaaaagttatatt
gttaaagaaccatatggcacagtactaattattgggccatttaactatccattccaattg
cttattgaaccgcttataggtgctatagctgcaggcaatactgtaatcattaaaccttcg
gaattcacgccacatgtgtcagcagttgtaaaaaatattattgaagatgtgttcgaccct
gaatacatcagtatttgccaaggtgacgccgatactacacagtcactgattcatttaccc
ttcgattatatctttttcaccggaagcgaacgcgttggaagaattgtttatcaagcagca
agtaccaatttaacacctgtcactttagaattaggtggcaaatcacctgtcatcgtagac
gaaaccgctaatatcaaagtcgctagtgaacgcatcagttttggtaaattcactaatgct
ggccaaacatgtgtcgctccagattatgttcttgtaaaccgtaaagtcaaagaagacttg
attaaagctttaaaaaatacaataacagaattttatggtaaagaaatacaagcaagtcct
gactttggacgtatcgtaaatcaaacgcattttgaccgtttaaacgatttattaggtgta
cacaaatcggaaattgtttttggtggccattctgattcagctgaaaactatatcggacct
actttattagatggtattacatttaatgataaaattatggaaggtgaaattttcggtcct
atactaccaattattacttatgacgattttgatgaagcgattgatttaattcatacgaaa
cccaagccactcagcctttacctattcagtgaagatgaaaacgcaacagaacgtgttcta
aatgaaatttcttttggtggcggtgctatcaacgatacattgatgcaattagcaaatcca
aacttaccattcggtggtgttggtgcttccggtattggtcaatatcacggcaaatttagt
tttgacacattcagtcatgataaatcttatatatttaaatcaactcgattagagtcaagc
ctactctttccaccttacaaaggaaaatttaagtatattaaaacatttttcaataaataa

DBGET integrated database retrieval system