KEGG   Staphylococcus saprophyticus: SSP0967Help
Entry
SSP0967           CDS       T00269                                 

Definition
(GenBank) protoporphyrinogen oxidase
  KO
K00231  protoporphyrinogen/coproporphyrinogen III oxidase [EC:1.3.3.4 1.3.3.15]
Organism
ssp  Staphylococcus saprophyticus
Pathway
ssp00860  Porphyrin and chlorophyll metabolism
ssp01100  Metabolic pathways
ssp01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:ssp00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    SSP0967
Enzymes [BR:ssp01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.3  With oxygen as acceptor
    1.3.3.4  protoporphyrinogen oxidase
     SSP0967
    1.3.3.15  coproporphyrinogen III oxidase (coproporphyrin-forming)
     SSP0967
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Amino_oxidase NAD_binding_8 DAO MCRA Thi4 Pyr_redox_2 HI0933_like NAD_binding_9 FAD_binding_2
Motif
Other DBs
NCBI-ProteinID: BAE18112
UniProt: Q49YM5
Position
1001215..1002609
Genome map
AA seq 464 aa AA seqDB search
MTKSIAIIGAGITGLSSAYFIKKQRPDIDVTIYEATNRTGGKIQTYRKDGYTIELGPESY
LGRKQIMTDIAKDIGLADELITNQTGQSYIYAKNKLFPIPGGSILGVPTNLKPFIKTKLI
SPKGKLRAGLDLFKKPIQIERDISVGSFFRERLGDEVLENLIEPLMGGIYGTNIDELSLM
STFPEFKEREEQFGSLIKGMRYEKMQRQKQRQLYPGAPKGQFKQFRHGLTSFIEKLTDYV
VNQGVKIRFNTPIDDIVISQTNYELVVDDEKNIYDSVLVTTPHQTFMKWFGNDPALDYFK
TMPSTTVATVVLAFDEQHIENTYDGTGFVIARTSQTDITACTWTSKKWPFTTPEGKVLIR
AYVGKPGDTVVKDHSDEELVDIVKRDLTQMMTFKGAPDFSIVNRLPNSMPQYRVDHMDNI
SAIQAHIKHNYPRLRIAGASFEAVGLPDCILQGKNAVSELLNEL
NT seq 1395 nt NT seq  +upstreamnt  +downstreamnt
ttgactaaaagtattgctattatcggagctggtatcacaggtttatctagtgcatatttt
ataaaaaaacaacgaccagatatagatgtgacgatatatgaagcgactaatcgaactggc
ggtaagattcaaacctatcgaaaagatggttatacgattgaattaggtccagaatcttat
ctaggacgcaaacagattatgacagacattgctaaagatattggattagcagatgaactt
atcactaatcaaacaggacaatcttatatttatgctaaaaataaactgtttcctattcca
gggggatctatcttaggtgtgccaactaaccttaaaccttttattaaaacaaaattgatt
tcgcctaaaggtaaattacgtgctggtttagatttatttaaaaagcctattcaaatagaa
cgcgatatttctgttgggtcattctttcgtgaacgtctaggagatgaagtcttagaaaat
ttaattgaacctttaatgggtggtatttatggtacaaacattgatgaattaagtttaatg
tctacttttccggagtttaaagaaagagaagaacagtttggtagtttaattaaaggtatg
cgatacgaaaaaatgcaacgtcaaaaacaacgacaattatatccaggagcaccaaaaggc
caatttaaacaatttaggcatgggctgacttcttttattgaaaaattaactgattatgtc
gtaaaccaaggtgtaaaaatcagatttaatacacctatagatgatatcgtcatctcacaa
acgaattatgagcttgttgtagatgatgaaaaaaatatctacgacagtgtccttgttacc
acaccacatcaaacctttatgaaatggtttggtaatgatccagcccttgattatttcaaa
acaatgccatctacaaccgttgcaactgttgtactagcatttgatgaacagcatattgaa
aatacctatgacggtacgggtttcgtgattgcaagaacgagccaaaccgatatcacagca
tgtacatggacaagtaaaaaatggccttttactacaccagaaggtaaggtgctgatacgt
gcttatgttggtaaaccaggtgatacggttgtgaaagatcattcagatgaagaacttgta
gatattgttaaacgagatttaacacaaatgatgacttttaaaggcgcaccagatttcagt
attgtgaatcgtttacctaatagtatgccgcaatatcgtgtggatcatatggataacata
tctgcgattcaagcgcatattaaacataattatcctaggttaagaatagccggtgcttca
tttgaagcggttggcctgccagactgtattttacaaggtaaaaatgcagtatcagaatta
ttaaatgaattatag

DBGET integrated database retrieval system