KEGG   Staphylococcus saprophyticus: SSP1030Help
Entry
SSP1030           CDS       T00269                                 

Definition
(GenBank) acetyl-coenzyme A synthetase
  KO
K01895  acetyl-CoA synthetase [EC:6.2.1.1]
Organism
ssp  Staphylococcus saprophyticus
Pathway
ssp00010  Glycolysis / Gluconeogenesis
ssp00620  Pyruvate metabolism
ssp00640  Propanoate metabolism
ssp00680  Methane metabolism
ssp01100  Metabolic pathways
ssp01110  Biosynthesis of secondary metabolites
ssp01120  Microbial metabolism in diverse environments
ssp01130  Biosynthesis of antibiotics
ssp01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:ssp00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SSP1030
   00620 Pyruvate metabolism
    SSP1030
   00640 Propanoate metabolism
    SSP1030
  Energy metabolism
   00680 Methane metabolism
    SSP1030
Enzymes [BR:ssp01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     SSP1030
Lipid biosynthesis proteins [BR:ssp01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   SSP1030
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AMP-binding AMP-binding_C
Motif
Other DBs
NCBI-ProteinID: BAE18175
UniProt: Q49YG4
Position
1064996..1066705
Genome map
AA seq 569 aa AA seqDB search
MKVEVYKGESGDFNLQDYEKEYNHFNWKDVEKSFSWYESGNVNMAHECIDRHVDEGKGDK
IALHYKDDKRKESYTFEEMKINSNKAANVLKEKANVEKGDRVFVFMPRTPELYFALFGTL
KIGAIVGPLFEAFMEKAVGDRLQNSEAKVIITTNALLPRIPKENLPHLETIVVVDETVDE
NYVDFNSEFQQASESFDTEWLTMDDGLILHYTSGSTGQPKGVLHAQRAMLLHYISGKYVL
DFKEDDVYWCTADPGWVTGTSYGIFSPWLSGVTNCIAGGRFSPEAWYSMIEEFKVTIWYT
APTALRMLMSAGDDVVEKYDLSSIKSILSVGEPLNPEVIKWAKDVFGKRVLDTWWMTETG
GHMIVNYPSMDVKLGSMGKPLPGVEAAIIDDQGNELPANRMGNLAIKKGWPSMMVSIWKN
PEKYDSYFIGDWYVSGDSAYKDEDGYYWFQGRVDDVIMTAGERVGPFEVESKLVEHEAVA
EAGVIGKPDPIRGEIIKAFVALRPDYQESDELKEEIRKFVKEGLAAHAAPREIEFKEKLP
KTRSGKIMRRVLKAWELDLPEGDLSTMED
NT seq 1710 nt NT seq  +upstreamnt  +downstreamnt
atgaaagtagaagtttataaaggtgaaagtggagattttaaccttcaagactatgaaaaa
gaatacaatcattttaactggaaagatgtagaaaaatcattttcatggtacgaatctggc
aatgttaatatggcacatgaatgtatagatcgtcatgtggacgaaggcaaaggggataaa
attgccttacattataaagatgataaacgtaaagaaagttatacttttgaagaaatgaaa
atcaattcaaataaagctgcgaatgttttaaaagaaaaagcaaatgttgaaaaaggagat
cgtgtttttgtatttatgccgagaacaccagaactctattttgcgttgtttggaactttg
aaaataggtgcaattgttggacctctatttgaagcatttatggaaaaagcggttggcgat
cgtttacaaaatagtgaagcaaaagtaattattacaacgaatgcgttacttcctagaatt
cctaaagaaaatctacctcatttagaaacaattgttgtcgtagacgaaaccgttgatgaa
aactatgtcgattttaatagtgaattccaacaagcaagtgagtcatttgatacagaatgg
ttaacaatggatgacggtttgatacttcactatacttctggttctaccggacaacctaaa
ggtgttttacatgcacaaagagcaatgctcttacattatatatcaggtaagtatgtatta
gattttaaagaggatgatgtttattggtgtactgcagatcctggttgggtcacaggaaca
tcatatggtatctttagtccttggttaagtggtgtaacaaactgtattgctggtggaaga
ttttcaccagaggcttggtacagtatgattgaagaatttaaagttaccatttggtataca
gcacctacagcacttagaatgttaatgagtgcaggggatgatgtagttgaaaaatatgat
ctttcttcaatcaagagtattttatctgttggcgaacctttaaatccagaggtcattaaa
tgggcaaaagatgtctttggcaaacgtgtactcgatacgtggtggatgacagaaactggt
ggtcatatgatcgtcaattatccttctatggatgtaaaattaggctcaatgggtaaacct
ttaccaggggtagaagcagcaatcattgatgatcaaggtaatgaattaccagcgaatcgt
atgggtaatctagcgattaaaaaaggttggccatctatgatggtgtccatttggaaaaat
ccagagaaatatgattcttatttcattggagattggtatgtatcaggcgactctgcatat
aaagatgaagatggctattattggttccaaggccgtgttgatgatgtgattatgacagct
ggtgaacgtgttggcccatttgaagttgagtctaaattggttgaacatgaagcagtagct
gaagcgggtgtaattggtaagccagatccaattcgtggtgaaattatcaaagcatttgtg
gcgttacgacctgattatcaagaatcagatgaacttaaagaagaaattcgtaagtttgta
aaagaaggcttagcggcacatgctgcaccaagagaaatcgaatttaaagaaaaattacca
aaaacacgttcgggtaaaatcatgcgtcgcgtattaaaagcatgggaattagatctgcca
gaaggcgatttaagtactatggaagactag

DBGET integrated database retrieval system