KEGG   Staphylococcus saprophyticus: SSP1068Help
Entry
SSP1068           CDS       T00269                                 

Definition
(GenBank) 6-phosphofructokinase
  KO
K00850  6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
ssp  Staphylococcus saprophyticus
Pathway
ssp00010  Glycolysis / Gluconeogenesis
ssp00030  Pentose phosphate pathway
ssp00051  Fructose and mannose metabolism
ssp00052  Galactose metabolism
ssp00680  Methane metabolism
ssp01100  Metabolic pathways
ssp01110  Biosynthesis of secondary metabolites
ssp01120  Microbial metabolism in diverse environments
ssp01130  Biosynthesis of antibiotics
ssp01200  Carbon metabolism
ssp01230  Biosynthesis of amino acids
ssp03018  RNA degradation
Module
ssp_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
ssp_M00345  Formaldehyde assimilation, ribulose monophosphate pathway
Brite
KEGG Orthology (KO) [BR:ssp00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SSP1068
   00030 Pentose phosphate pathway
    SSP1068
   00051 Fructose and mannose metabolism
    SSP1068
   00052 Galactose metabolism
    SSP1068
  Energy metabolism
   00680 Methane metabolism
    SSP1068
 Genetic Information Processing
  Folding, sorting and degradation
   03018 RNA degradation
    SSP1068
Enzymes [BR:ssp01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     SSP1068
Protein phosphatases and associated proteins [BR:ssp01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     SSP1068
Messenger RNA biogenesis [BR:ssp03019]
 Prokaryotic Type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Other RNA degradosome components
     SSP1068
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PFK
Motif
Other DBs
NCBI-ProteinID: BAE18213
UniProt: Q49YC8
Position
1109986..1110909
Genome map
AA seq 307 aa AA seqDB search
MNAAVRAVVRKAIYNNIEVYGVYQGYQGLLNDDIEKLELGSVGDTIQRGGTFLYSARCPE
FKEVEVRKKGIENLRKRGIEGLVVIGGDGSYRGAQRISEECPEIQTIGIPGTIDNDINGS
DFTIGFDTALNTIIECVDKIRDTASSHARTFIIEVMGRDCGDLALWAGLSVGAETIIVPE
VETDIKDIAEKIDNGIKRGKKHSIVMVAEGCMSGEVCAEELTKYINVDARVSVLGHIQRG
GSPSGADRVLASRLGGHAVDLLLDGKSAIGVGIRNNELTDTPFDEIFRSHEHEFDFETYA
LTNELSI
NT seq 924 nt NT seq  +upstreamnt  +downstreamnt
atgaatgcagcggtaagagctgtggttagaaaagcgatttacaataatattgaagtctat
ggtgtttatcaaggctatcaaggattattaaacgatgatatcgagaaacttgaactcggt
tcagtaggtgacacaattcaacgaggtggaacatttttatattctgcaagatgtccagaa
tttaaagaagtagaagtccgtaaaaaaggtatagaaaatctacgtaagagaggcattgag
gggcttgtagttattggtggagatggtagctacagaggtgcacagcgtataagtgaagaa
tgtcctgaaatacagacgattggaataccaggtacgattgataatgatatcaatggttcg
gactttacaattggatttgatacggcattaaatactataattgaatgtgtagataaaatt
cgtgatacagcatctagtcatgcaagaactttcatcattgaagttatgggacgcgattgt
ggtgatttagcgctttgggctggtttgtccgttggtgctgaaactattattgttccagag
gttgagacagacatcaaagatatagcagaaaagattgataatggaatcaaacgtggcaaa
aaacactcaatcgtgatggtcgcagaaggttgcatgtcaggtgaagtatgtgcagaagaa
ttgactaaatatatcaatgttgatgcacgtgtgtcagtgctaggccacattcaacgtggt
ggtagcccaagtggtgcagatagagtgcttgcatcacgattaggcggacatgcagttgat
ttactgttagatggaaaatctgctattggtgttggaattcgtaataatgaattaactgat
acaccttttgacgagatatttagatcacatgaacatgagtttgattttgaaacttatgcg
ctaacgaatgaattatctatttaa

DBGET integrated database retrieval system