KEGG   Staphylococcus saprophyticus: SSP1068Help
Entry
SSP1068           CDS       T00269                                 

Definition
6-phosphofructokinase (EC:2.7.1.11)
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
ssp  Staphylococcus saprophyticus
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Formaldehyde assimilation, ribulose monophosphate pathway
Brite
KEGG Orthology (KO) [BR:ssp00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    SSP1068
   01230 Biosynthesis of amino acids
    SSP1068
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SSP1068
   00030 Pentose phosphate pathway
    SSP1068
   00051 Fructose and mannose metabolism
    SSP1068
   00052 Galactose metabolism
    SSP1068
  Energy metabolism
   00680 Methane metabolism
    SSP1068
Enzymes [BR:ssp01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     SSP1068
Protein phosphatases and associated proteins [BR:ssp01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     SSP1068
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1109986..1110909
Genome map
AA seq 307 aa AA seqDB search
MNAAVRAVVRKAIYNNIEVYGVYQGYQGLLNDDIEKLELGSVGDTIQRGGTFLYSARCPE
FKEVEVRKKGIENLRKRGIEGLVVIGGDGSYRGAQRISEECPEIQTIGIPGTIDNDINGS
DFTIGFDTALNTIIECVDKIRDTASSHARTFIIEVMGRDCGDLALWAGLSVGAETIIVPE
VETDIKDIAEKIDNGIKRGKKHSIVMVAEGCMSGEVCAEELTKYINVDARVSVLGHIQRG
GSPSGADRVLASRLGGHAVDLLLDGKSAIGVGIRNNELTDTPFDEIFRSHEHEFDFETYA
LTNELSI
NT seq 924 nt NT seq  +upstreamnt  +downstreamnt
atgaatgcagcggtaagagctgtggttagaaaagcgatttacaataatattgaagtctat
ggtgtttatcaaggctatcaaggattattaaacgatgatatcgagaaacttgaactcggt
tcagtaggtgacacaattcaacgaggtggaacatttttatattctgcaagatgtccagaa
tttaaagaagtagaagtccgtaaaaaaggtatagaaaatctacgtaagagaggcattgag
gggcttgtagttattggtggagatggtagctacagaggtgcacagcgtataagtgaagaa
tgtcctgaaatacagacgattggaataccaggtacgattgataatgatatcaatggttcg
gactttacaattggatttgatacggcattaaatactataattgaatgtgtagataaaatt
cgtgatacagcatctagtcatgcaagaactttcatcattgaagttatgggacgcgattgt
ggtgatttagcgctttgggctggtttgtccgttggtgctgaaactattattgttccagag
gttgagacagacatcaaagatatagcagaaaagattgataatggaatcaaacgtggcaaa
aaacactcaatcgtgatggtcgcagaaggttgcatgtcaggtgaagtatgtgcagaagaa
ttgactaaatatatcaatgttgatgcacgtgtgtcagtgctaggccacattcaacgtggt
ggtagcccaagtggtgcagatagagtgcttgcatcacgattaggcggacatgcagttgat
ttactgttagatggaaaatctgctattggtgttggaattcgtaataatgaattaactgat
acaccttttgacgagatatttagatcacatgaacatgagtttgattttgaaacttatgcg
ctaacgaatgaattatctatttaa

DBGET integrated database retrieval system