KEGG   Staphylococcus saprophyticus: SSP1068Help
Entry
SSP1068           CDS       T00269                                 

Definition
6-phosphofructokinase (EC:2.7.1.11)
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
ssp  Staphylococcus saprophyticus
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Formaldehyde assimilation, ribulose monophosphate pathway
Class
Metabolism; Overview; Carbon metabolism [PATH:ssp01200]
Metabolism; Overview; Biosynthesis of amino acids [PATH:ssp01230]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:ssp00010]
Metabolism; Carbohydrate metabolism; Pentose phosphate pathway [PATH:ssp00030]
Metabolism; Carbohydrate metabolism; Fructose and mannose metabolism [PATH:ssp00051]
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:ssp00052]
Metabolism; Energy metabolism; Methane metabolism [PATH:ssp00680]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1109986..1110909
Genome map
AA seq 307 aa AA seqDB search
MNAAVRAVVRKAIYNNIEVYGVYQGYQGLLNDDIEKLELGSVGDTIQRGGTFLYSARCPE
FKEVEVRKKGIENLRKRGIEGLVVIGGDGSYRGAQRISEECPEIQTIGIPGTIDNDINGS
DFTIGFDTALNTIIECVDKIRDTASSHARTFIIEVMGRDCGDLALWAGLSVGAETIIVPE
VETDIKDIAEKIDNGIKRGKKHSIVMVAEGCMSGEVCAEELTKYINVDARVSVLGHIQRG
GSPSGADRVLASRLGGHAVDLLLDGKSAIGVGIRNNELTDTPFDEIFRSHEHEFDFETYA
LTNELSI
NT seq 924 nt NT seq  +upstreamnt  +downstreamnt
atgaatgcagcggtaagagctgtggttagaaaagcgatttacaataatattgaagtctat
ggtgtttatcaaggctatcaaggattattaaacgatgatatcgagaaacttgaactcggt
tcagtaggtgacacaattcaacgaggtggaacatttttatattctgcaagatgtccagaa
tttaaagaagtagaagtccgtaaaaaaggtatagaaaatctacgtaagagaggcattgag
gggcttgtagttattggtggagatggtagctacagaggtgcacagcgtataagtgaagaa
tgtcctgaaatacagacgattggaataccaggtacgattgataatgatatcaatggttcg
gactttacaattggatttgatacggcattaaatactataattgaatgtgtagataaaatt
cgtgatacagcatctagtcatgcaagaactttcatcattgaagttatgggacgcgattgt
ggtgatttagcgctttgggctggtttgtccgttggtgctgaaactattattgttccagag
gttgagacagacatcaaagatatagcagaaaagattgataatggaatcaaacgtggcaaa
aaacactcaatcgtgatggtcgcagaaggttgcatgtcaggtgaagtatgtgcagaagaa
ttgactaaatatatcaatgttgatgcacgtgtgtcagtgctaggccacattcaacgtggt
ggtagcccaagtggtgcagatagagtgcttgcatcacgattaggcggacatgcagttgat
ttactgttagatggaaaatctgctattggtgttggaattcgtaataatgaattaactgat
acaccttttgacgagatatttagatcacatgaacatgagtttgattttgaaacttatgcg
ctaacgaatgaattatctatttaa

DBGET integrated database retrieval system