KEGG   Staphylococcus saprophyticus: SSP1095Help
Entry
SSP1095           CDS       T00269                                 

Definition
(GenBank) uroporphyrinogen III synthase
  KO
K01719  uroporphyrinogen-III synthase [EC:4.2.1.75]
Organism
ssp  Staphylococcus saprophyticus
Pathway
ssp00860  Porphyrin and chlorophyll metabolism
ssp01100  Metabolic pathways
ssp01110  Biosynthesis of secondary metabolites
ssp01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:ssp00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    SSP1095
Enzymes [BR:ssp01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.75  uroporphyrinogen-III synthase
     SSP1095
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HEM4
Motif
Other DBs
NCBI-ProteinID: BAE18240
UniProt: Q49YA1
Position
1143238..1143924
Genome map
AA seq 228 aa AA seqDB search
MRPVIVMTQTSEFYKSDVCILHKPFINVEPLSFNLNLLDVNYDWLIFSSKKAVEYFKPYL
SKLNYKKIAVIGEKTADYCTSIGLKVSFCPKDYSQEGFLKAFKTHEQSNILLPSSAAARS
TLEEGLKQQNYNVQKIDLYEPVPHTKHIKHVKMLIEQGKVDAITFASSSAVRYFFEDNQN
VSFNNYFVIGQQTLDTLNHYQKQGIVADIQTLDALVNKILESWEENAI
NT seq 687 nt NT seq  +upstreamnt  +downstreamnt
atgagaccagttatagtaatgactcaaacgagtgaattttataaatcagatgtatgtata
ctacataaacctttcataaatgtagaaccattatcatttaatctgaatttactcgatgtt
aattatgactggcttattttttcgtccaaaaaagctgtggaatacttcaaaccctactta
tctaaactgaattacaaaaaaattgctgtgattggtgaaaaaactgcagattattgtact
tcaattggattgaaagtatcattttgtcctaaagactattcgcaagaaggatttctgaaa
gcatttaaaacacatgaacaaagcaatattttattaccttctagtgcagctgctaggtcc
acgcttgaagaaggattgaaacaacaaaattataatgttcaaaagattgatttatatgag
cctgtgccacatacaaagcatattaagcatgttaaaatgttgattgagcaaggcaaagtg
gatgcaattacattcgcaagttcatccgcagtgcgttatttttttgaagataatcaaaac
gtatcatttaataattattttgtgatagggcaacaaacgctagatacattgaatcattat
caaaaacaaggtatcgttgctgatatacagacattagatgctttagttaataaaatttta
gaaagttgggaagaaaatgcaatttga

DBGET integrated database retrieval system