KEGG   Staphylococcus saprophyticus: SSP1096Help
Entry
SSP1096           CDS       T00269                                 

Definition
delta-aminolevulinic acid dehydratase (EC:4.2.1.24)
Orthology
K01698  
porphobilinogen synthase [EC:4.2.1.24]
Organism
ssp  Staphylococcus saprophyticus
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:ssp00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    SSP1096
Enzymes [BR:ssp01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.24  porphobilinogen synthase
     SSP1096
Exosome [BR:ssp04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   SSP1096
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1143914..1144891
Genome map
AA seq 325 aa AA seqDB search
MQFDRHRRLRSSKSMRNLVRETHVNKEDLIYPIFVVERDNVKEEIKSLPGVYQLSLNVLD
EEIKEAYDLGIRGVMFFGVPNEKDAIGTGAYDHNGIVQEATRKAKAMYDDLLVVADTCLC
EYTDHGHCGVINEQTKDVDNDKSLPLLVKTAISQVEAGADIIAPSNMMDGFVAEIRAGLD
DAGYYNVPIMSYGIKYASSFFGPFRDAAESTPQFGDRKTYQMDPANRREALRELDSDLRE
GADMMIVKPALSFLDIIRDVRNTTNVPVVAYNVSGEYSMTKAASLNGWIDEKAVVMEQMT
SMKRAGADMIITYFSKDICRYLDEQ
NT seq 978 nt NT seq  +upstreamnt  +downstreamnt
atgcaatttgatagacatagacgtttacgtagtagtaaatcaatgagaaatttagttaga
gaaacacatgtgaacaaagaagatttaatttatccaatctttgtagtagaacgtgataat
gttaaagaagaaattaaatcattgcctggcgtttaccaattaagcttaaatgtattagac
gaagaaattaaagaagcatatgatttaggcattagaggtgttatgtttttcggtgttcca
aatgaaaaagatgctataggaacaggtgcatatgatcataatgggattgttcaagaagct
acaagaaaagcaaaggctatgtatgatgacttattagttgttgcagatacatgcttatgt
gaatatacagaccacggtcattgtggtgtcattaatgaacaaacgaaagatgtagataac
gataaatcactaccattattagtgaaaacagctatatcacaagttgaagctggtgcggat
atcattgcacctagtaatatgatggacggctttgttgctgaaatcagagcaggtctagat
gacgctggatattataatgtcccaattatgagttacggaattaaatatgcatcaagtttc
tttggtcctttccgtgatgctgcagaatcaacaccacagtttggagatcgtaagacttat
caaatggatccagctaatcgtagagaagcattgagagaactagatagtgatttacgtgag
ggcgcagatatgatgattgttaaaccagcccttagcttcttagatattattagagatgtt
agaaatactacgaacgttccagttgttgcatataatgtaagtggtgagtacagtatgact
aaagccgcatcattgaatggttggatagacgaaaaagcagttgttatggaacaaatgact
tccatgaaacgtgctggtgcggatatgattattacgtatttttcaaaagatatttgtcgt
tatttagacgaacaatag

DBGET integrated database retrieval system