KEGG   Staphylococcus saprophyticus: SSP1117Help
Entry
SSP1117           CDS       T00269                                 

Gene name
ruvA
Definition
Holliday junction DNA helicase RuvA
Orthology
K03550  
holliday junction DNA helicase RuvA [EC:3.6.4.12]
Organism
ssp  Staphylococcus saprophyticus
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:ssp00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    SSP1117 (ruvA)
Enzymes [BR:ssp01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.12  DNA helicase
     SSP1117 (ruvA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1162121..1162723
Genome map
AA seq 200 aa AA seqDB search
MYAYIKGTLTELNPTHVVVEASGVGYEIQTPNSYRFQKYMDHEVVVHTSLIVREDAQLLY
GFINQEEKDMFLSLIKVTGIGPKSALAILASSSPNDVKIAIENENDAYLTKFPGIGKKTA
RQIVLDLKGKVQINDVDSSQILNTDTQDHANAPIIKEALLALEALGYSKRELTKVEKSLS
KETFDSVDDAVKRGLQLLIA
NT seq 603 nt NT seq  +upstreamnt  +downstreamnt
atgtacgcatatattaaaggcacattaactgaattaaaccctacacacgtagttgttgag
gcttcaggtgttggttatgaaatacaaacgccaaattcttatcgttttcagaaatacatg
gaccatgaagtggttgtacatacatcacttatcgtgcgagaagatgcacaattgctttat
ggttttataaatcaagaagaaaaagatatgtttttaagcctaattaaggtaactggcatc
ggacctaaatcagcattggctatactcgcaagtagttcaccaaacgatgtcaaaatagca
attgaaaatgaaaatgatgcttacttaacaaaatttcctggcataggcaaaaaaacagcg
agacaaattgtattggatcttaaaggcaaggtccaaattaatgatgtagacagtagccaa
attttaaatacggatactcaggaccacgctaatgcaccgattattaaagaagctttgctt
gctctagaagctttagggtactctaagcgagaattaacaaaagttgaaaaatcattgagt
aaagaaacatttgactcagtagacgatgcggttaaacgaggcttacaattacttatagca
taa

DBGET integrated database retrieval system