KEGG   Staphylococcus saprophyticus: SSP1142Help
Entry
SSP1142           CDS       T00269                                 

Definition
ATP-dependent exonuclease V alpha subunit
Orthology
K03581  
exodeoxyribonuclease V alpha subunit [EC:3.1.11.5]
Organism
ssp  Staphylococcus saprophyticus
Pathway
Homologous recombination
Class
Genetic Information Processing; Replication and repair; Homologous recombination [PATH:ssp03440]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1188933..1191317
Genome map
AA seq 794 aa AA seqDB search
MGDPTLFNNSMIKGTVDAILFQNKENFYTVLKVDTIESSETFDSMPTIVGFFPEIAEGDV
YTFKGQVVTHPKYGKQLKAETFEKELPQTKEAIISYLSSDLFKGIGKKTAQSIVNKLGEN
AINDILNDPSVLEQVPGLPKKKQKQIAEQIASNQETEQIIIRLHDLGFGPKLAMAIYQAY
LGETLNVVENKPYQLVYDVKGIGFNKADTLARNVGIQFNDTERLKAGLLYVLEEECIKQG
HTYLPTQNVLEMTQDMLSQAPSEIIEMQQLNHVLQELVNDTKLIQQENEVAIPSLYYSEL
KSVQNLYRNYAYKNKLKQIEQSDLLMKIGEIEERNQVNYANSQKDALQTAINSKIMLLTG
GPGTGKTTVIKGIVELYAEIHGLSLNYDDYQNDDYPVVLGAPTGRASKRLAESTGLEAMT
IHRLIGWNQDTQPEDILDNEISAKLIIIDEMSMVDTWLFHQFLSAVPIDAQIILVGDEDQ
LPSVGPGQVFKDLIDSKVIPRVNLTEVYRQQDGSSIIELAHRMKLGEPIDITQRFHDRNF
INCNTDQIPTVVEKVVSSAVNKGYDMSDIQVLAPMYKGSAGIKKLNMVLQDILNPKDKDT
REIEFGDVFFRKGDKVLQLVNRPNDNIFNGDIGVIVGVFWAKENALNKDVLVVDFEGNEI
TFVRQDLIELTHAYCTSIHKSQGSEFPIVIMPMVKQYFRMLQKPILYTGLTRAKQSLVFL
GDPQAFDIGLKTHGQVRMTQLCTFLKAYFNNDASTEEEISDTFDADIILTEDNIFKINPM
INMGDISPYDFVED
NT seq 2385 nt NT seq  +upstreamnt  +downstreamnt
atgggagaccctacactatttaataattcaatgattaaaggaaccgttgatgcgatttta
tttcaaaataaagaaaatttttatacggttttaaaagttgatacaattgagtcaagtgaa
acatttgattcaatgcctacgattgtagggtttttcccagaaattgctgaaggtgatgtt
tatacattcaaaggccaagttgttacacatccgaagtatggtaaacaacttaaagctgaa
acgtttgaaaaagaattaccacaaactaaagaggcaattattagttatttatcaagtgat
ttatttaaaggtattggtaaaaaaactgcgcaaagtattgttaataaactaggtgaaaat
gctataaacgatatcttaaatgacccgtcggtattagagcaagtacctggtttacctaag
aaaaagcaaaaacaaatagctgaacaaattgctagtaatcaagagacggagcaaattatc
atacgcttacatgatttagggtttggaccaaaactagctatggcgatttaccaagcgtat
ttaggagaaacacttaatgttgttgaaaataaaccctaccaactcgtatatgatgtaaaa
ggaattggatttaataaagctgataccttagcacgtaatgttggaatccagttcaatgat
acagaaagactaaaagcgggtttgttatatgtacttgaagaggaatgtattaagcaagga
catacatatttacctactcaaaatgtattagaaatgactcaagatatgctttctcaagca
cctagtgaaataatagaaatgcaacaattgaatcatgtattacaagaattggtaaatgat
accaaactcattcaacaagaaaatgaagttgcaattccgagtttatattattcagaatta
aaaagtgtgcagaatctttatcgcaattatgcgtataagaataaactcaaacaaatagaa
cagtctgatcttttaatgaagattggagaaattgaagagcgcaatcaagttaattatgca
aattcacaaaaagatgcgttacagactgctattaattctaaaattatgctgctcacaggt
ggccctggtacaggtaaaacaactgtgataaaaggtattgtagaattatatgcagaaatt
catggtctctcattaaattatgatgattatcaaaatgatgattatccagtcgtattaggt
gcgcctacaggaagagcttcaaagcgtttggcagagtcgacaggtttagaagccatgaca
attcatcgcttaatcggatggaatcaggatacacaaccggaagatattttagataatgaa
atatcagcaaaattaattatcattgatgagatgtctatggttgatacttggctgtttcac
caatttttaagtgcagttccaatagatgcacaaatcattttagtaggtgatgaagatcaa
ttgccttctgtaggtcctggtcaagtatttaaagatttaattgattcaaaagtgatacct
cgtgttaatttaacagaagtttatagacaacaagatggttctagtattattgaattagcg
catcggatgaaactaggtgaaccgattgatataacccaacgttttcatgatcgaaatttt
ataaattgtaatacagatcagattccgacagttgtggaaaaagttgtttcaagcgctgtg
aataaaggctatgatatgagtgacattcaagtgcttgcaccaatgtataaagggtcagca
ggcattaaaaaacttaatatggtattacaagatattttaaatcctaaggataaagataca
cgtgaaatagaatttggtgatgtgttttttagaaaaggtgacaaagtcttgcaacttgta
aataggcctaatgataatattttcaacggtgatattggtgtaatcgtgggtgttttttgg
gcaaaagaaaatgcgttgaacaaagatgtattagtcgttgattttgaaggtaatgaaatt
acttttgttcgtcaagatttaatagaattaactcatgcttattgtacgtcgatccataaa
tcacaaggttctgaattcccaatagtcatcatgcctatggtaaaacaatactttagaatg
ctacaaaagcccatattatatactggcttaacaagggctaaacaatcccttgtcttttta
ggtgatccgcaagcctttgatattggtttaaaaacgcatggacaagtgagaatgacacag
ttatgcacatttttaaaagcctactttaataacgatgcatctactgaagaagaaatcagc
gacacatttgatgctgatatcattctaactgaagacaatatttttaaaattaacccaatg
attaatatgggagatatttccccatatgacttcgttgaagattga

DBGET integrated database retrieval system