KEGG   Staphylococcus saprophyticus: SSP1209Help
Entry
SSP1209           CDS       T00269                                 

Definition
glucose kinase
Orthology
K00845  
glucokinase [EC:2.7.1.2]
Organism
ssp  Staphylococcus saprophyticus
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Class
Metabolism; Overview; Carbon metabolism [PATH:ssp01200]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:ssp00010]
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:ssp00052]
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:ssp00500]
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:ssp00520]
Metabolism; Biosynthesis of other secondary metabolites; Streptomycin biosynthesis [PATH:ssp00521]
Metabolism; Biosynthesis of other secondary metabolites; Butirosin and neomycin biosynthesis
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1252961..1253947
Genome map
AA seq 328 aa AA seqDB search
MNKIILAADIGGTTCKLGCFDENLNRISKWSINTDTSDTTGYQLLKNIYNAFVAYIDQSD
YTFSDVIGVGIGVPGPVNFETGEVNGAVNLYWTEPVNVRNIFKQFVDCPVYVDNDANVAA
LGEKHKGAGNGVDDVVAITLGTGLGGGIISNGEIVHGHNGSGAEIGHFRVDHDQRFKCNC
GKSGCIETVASATGVVNLVNFYYPKLTFKSSILQLIKENNVTAKAVFDAAKAGDQFCIFI
TERVANYIAYLCSILSVTSNPKYIVLGGGMSTAGLILIENIKTEYHNLTFTPAQKDTEIV
QAQLGNDAGITGAAGLIYTYVIEKEGAK
NT seq 987 nt NT seq  +upstreamnt  +downstreamnt
atgaataaaatcatactagcagcagatataggtggtacaacttgtaaattaggttgtttt
gatgaaaatttaaatcgtatttcaaaatggtcaattaacacggatacatcagatacaacg
ggttatcaattgttgaaaaatatttataatgcttttgtcgcatatattgatcaatctgat
tatactttttctgatgttatcggtgttggtataggagttcctggtcctgttaattttgaa
acgggtgaagttaacggtgcagtcaatttatattggacggaaccagtaaatgttaggaat
attttcaaacaatttgttgattgtccagtttatgttgataatgacgctaacgtagctgca
ctaggagagaaacataaaggtgcaggtaatggtgttgatgatgtagttgcaattacactt
ggcacaggacttggcggaggtattatttcgaatggcgaaatcgtacatggacacaatggt
tcaggagctgaaattggtcatttccgagtagaccatgaccaacgttttaaatgtaattgt
ggtaaatcgggttgtattgaaacagttgcatctgctacaggcgtagttaatcttgttaac
ttttattatccaaaattaacttttaagtcatctatactccaattaataaaagaaaataat
gtaactgcaaaagctgtttttgatgcggcgaaagcaggagatcaattctgcatatttatc
acagaacgcgttgctaattatattgcttatttatgtagtattttaagtgtaacgagtaac
cctaaatacattgttttaggtggtggtatgtcaactgcgggacttattttgattgaaaac
attaaaacggaatatcataatttaactttcactccagcacagaaagatactgaaatcgta
caagcgcaacttggcaatgatgcaggcattacaggtgctgcaggtttaatatatacttat
gtaattgaaaaggaaggtgcaaaataa

DBGET integrated database retrieval system