KEGG   Staphylococcus saprophyticus: SSP1313Help
Entry
SSP1313           CDS       T00269                                 

Definition
(GenBank) dihydrofolate reductase
  KO
K00287  dihydrofolate reductase [EC:1.5.1.3]
Organism
ssp  Staphylococcus saprophyticus
Pathway
ssp00670  One carbon pool by folate
ssp00790  Folate biosynthesis
ssp01100  Metabolic pathways
Module
ssp_M00126  Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:ssp00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    SSP1313
   00670 One carbon pool by folate
    SSP1313
Enzymes [BR:ssp01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.3  dihydrofolate reductase
     SSP1313
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DHFR_1
Motif
Other DBs
NCBI-ProteinID: BAE18458
UniProt: Q49XN7
Position
1357731..1358216
Genome map
AA seq 161 aa AA seqDB search
MTLSILVAHDQQRVIGVNNQLPWHLPSDLKHVKSLTTGNTLVMGRATFESIGKPLPNRRN
VVLTRNKSFKPEGVDVIHSFEEIYDLPGHVFIFGGQSLFEEMIDKVDDMYITVIEDKYNG
DTFFPPYTFKDWEVASSNKGVLDEKNTIPHTFLHLIRKGTS
NT seq 486 nt NT seq  +upstreamnt  +downstreamnt
atgacactttcaatacttgtagcccatgatcaacaacgggttattggcgtaaataaccaa
ttgccttggcatttacctagtgatttaaagcacgttaagtcgttaactactggaaatacg
cttgtcatgggtcgtgcaacatttgaatctatcgggaaacctcttcctaatagaagaaat
gttgtgttaactagaaataaatcatttaaaccagagggtgtggatgttatccattctttc
gaagaaatctacgacttacctggccatgtttttatatttggtggccagtccttatttgaa
gaaatgatagataaggttgatgatatgtatattactgttattgaagataaatataacggt
gatacttttttcccaccatatacttttaaagactgggaagtcgcatcatcaaataaaggt
gtattggatgaaaaaaatacgattcctcatacctttttacatttaatccgcaagggaact
tcatag

DBGET integrated database retrieval system