KEGG   Staphylococcus saprophyticus: SSP1326Help
Entry
SSP1326           CDS       T00269                                 

Definition
dihydrolipoamide succinyltransferase (EC:2.3.1.61)
Orthology
K00658  
2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
ssp  Staphylococcus saprophyticus
Pathway
Citrate cycle (TCA cycle)
Lysine degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:ssp00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    SSP1326
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    SSP1326
  Amino acid metabolism
   00310 Lysine degradation
    SSP1326
Enzymes [BR:ssp01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     SSP1326
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1370272..1371546
Genome map
AA seq 424 aa AA seqDB search
MPEVKVPELAESITEGTIAEWLKQVGDSVDKGEAIVELETDKVNVEVVSEEAGVLQELLA
NEGDTVEVGQAIAVVGEGSGNNTSEAPAKQEAPKQETETSTDDKSAQPAEATSNDTDDKS
QDNNQRVNATPSARKYAREKGIDLSEIAAASNDVVRKEHVDQSQTQTSTQQQAQPAAKEE
TKKLTQQNPSKPVIREKMSRRKKTAAKKLLEVSNNTAMLTTFNEIDMTNVMDLRKRKKEQ
FIKDHDGTKLGFMSFFTKAAVAALKKYPEVNAEIDGDDMITKQYYDIGVAVSTEDGLLVP
FVRDCDKKNFAEIEDEIGNLAKKARDKKLGLDDMVNGSFTITNGGIFGSMMSTPIINGSQ
AAILGMHSIITRPIAIDADTIENRPMMYIALSYDHRIIDGKEAVGFLKTIKELIENPEDL
LLES
NT seq 1275 nt NT seq  +upstreamnt  +downstreamnt
atgccagaggtaaaagttccagaattagcagaatccataacagaaggtaccattgcagaa
tggttaaaacaagtcggtgatagcgttgataaaggcgaagctatcgttgaattagaaacg
gacaaagttaacgttgaagtcgtttcagaagaagctggtgtacttcaagaattattagca
aatgaaggcgatacggttgaagtaggccaagctattgcagttgtaggtgaaggcagtggt
aataacacttcagaagcacctgcgaaacaagaagcacctaaacaagaaactgaaacatct
acagacgacaaatcagcgcaaccagctgaagcaactagcaatgatacagatgataaatca
caagataataaccaacgcgttaatgcaacaccatctgcacgtaaatacgcacgcgaaaaa
ggtattgatttatctgaaatagctgcagcttcaaatgatgtagttagaaaagaacatgtt
gatcaaagccaaactcaaacaagcacccaacaacaagcacaaccggctgctaaagaagaa
acgaaaaaactaacacaacaaaatccatcaaaacctgtaatcagagaaaaaatgtctcgt
cgtaagaaaacagcagcgaaaaaattattagaagtttctaataacacagctatgttaact
acatttaatgaaattgacatgacaaatgttatggatttacgtaaacgtaaaaaagaacaa
tttattaaagatcacgacggtactaaacttggtttcatgtcattcttcacaaaagctgca
gttgctgcattgaagaaatatcctgaagtcaatgctgaaattgatggagacgatatgatt
actaaacaatattatgatattggagttgccgtatctacagaagatggtttacttgtacct
ttcgtcagagattgcgataagaaaaactttgctgaaatcgaagatgaaattggcaactta
gcgaagaaagcacgcgacaaaaaacttggtttagacgacatggttaatggatcattcacg
attaccaacggcggtatctttggttcaatgatgtctacaccaattatcaatggtagccaa
gctgcaattctaggtatgcactcaattattacgcgtccaattgctatcgatgcagataca
attgaaaatcgcccaatgatgtatattgcattaagctatgatcatagaattatcgatggt
aaagaagcagtaggattcttaaaaacaatcaaagaattaattgaaaacccagaagattta
ctattagaatcttaa

DBGET integrated database retrieval system