KEGG   Staphylococcus saprophyticus: SSP1326Help
Entry
SSP1326           CDS       T00269                                 

Definition
dihydrolipoamide succinyltransferase (EC:2.3.1.61)
Orthology
K00658  
2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
ssp  Staphylococcus saprophyticus
Pathway
Citrate cycle (TCA cycle)
Lysine degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:ssp00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    SSP1326
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    SSP1326
  Amino acid metabolism
   00310 Lysine degradation
    SSP1326
Enzymes [BR:ssp01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     SSP1326
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1370272..1371546
Genome map
AA seq 424 aa AA seqDB search
MPEVKVPELAESITEGTIAEWLKQVGDSVDKGEAIVELETDKVNVEVVSEEAGVLQELLA
NEGDTVEVGQAIAVVGEGSGNNTSEAPAKQEAPKQETETSTDDKSAQPAEATSNDTDDKS
QDNNQRVNATPSARKYAREKGIDLSEIAAASNDVVRKEHVDQSQTQTSTQQQAQPAAKEE
TKKLTQQNPSKPVIREKMSRRKKTAAKKLLEVSNNTAMLTTFNEIDMTNVMDLRKRKKEQ
FIKDHDGTKLGFMSFFTKAAVAALKKYPEVNAEIDGDDMITKQYYDIGVAVSTEDGLLVP
FVRDCDKKNFAEIEDEIGNLAKKARDKKLGLDDMVNGSFTITNGGIFGSMMSTPIINGSQ
AAILGMHSIITRPIAIDADTIENRPMMYIALSYDHRIIDGKEAVGFLKTIKELIENPEDL
LLES
NT seq 1275 nt NT seq  +upstreamnt  +downstreamnt
atgccagaggtaaaagttccagaattagcagaatccataacagaaggtaccattgcagaa
tggttaaaacaagtcggtgatagcgttgataaaggcgaagctatcgttgaattagaaacg
gacaaagttaacgttgaagtcgtttcagaagaagctggtgtacttcaagaattattagca
aatgaaggcgatacggttgaagtaggccaagctattgcagttgtaggtgaaggcagtggt
aataacacttcagaagcacctgcgaaacaagaagcacctaaacaagaaactgaaacatct
acagacgacaaatcagcgcaaccagctgaagcaactagcaatgatacagatgataaatca
caagataataaccaacgcgttaatgcaacaccatctgcacgtaaatacgcacgcgaaaaa
ggtattgatttatctgaaatagctgcagcttcaaatgatgtagttagaaaagaacatgtt
gatcaaagccaaactcaaacaagcacccaacaacaagcacaaccggctgctaaagaagaa
acgaaaaaactaacacaacaaaatccatcaaaacctgtaatcagagaaaaaatgtctcgt
cgtaagaaaacagcagcgaaaaaattattagaagtttctaataacacagctatgttaact
acatttaatgaaattgacatgacaaatgttatggatttacgtaaacgtaaaaaagaacaa
tttattaaagatcacgacggtactaaacttggtttcatgtcattcttcacaaaagctgca
gttgctgcattgaagaaatatcctgaagtcaatgctgaaattgatggagacgatatgatt
actaaacaatattatgatattggagttgccgtatctacagaagatggtttacttgtacct
ttcgtcagagattgcgataagaaaaactttgctgaaatcgaagatgaaattggcaactta
gcgaagaaagcacgcgacaaaaaacttggtttagacgacatggttaatggatcattcacg
attaccaacggcggtatctttggttcaatgatgtctacaccaattatcaatggtagccaa
gctgcaattctaggtatgcactcaattattacgcgtccaattgctatcgatgcagataca
attgaaaatcgcccaatgatgtatattgcattaagctatgatcatagaattatcgatggt
aaagaagcagtaggattcttaaaaacaatcaaagaattaattgaaaacccagaagattta
ctattagaatcttaa

DBGET integrated database retrieval system