KEGG   Staphylococcus saprophyticus: SSP1373Help
Entry
SSP1373           CDS       T00269                                 

Gene name
trpA
Definition
(RefSeq) tryptophan synthase subunit alpha (EC:4.2.1.20)
  KO
K01695  
tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
ssp  Staphylococcus saprophyticus
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:ssp00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    SSP1373 (trpA)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    SSP1373 (trpA)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    SSP1373 (trpA)
Enzymes [BR:ssp01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     SSP1373 (trpA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1418525..1419250)
Genome map
AA seq 241 aa AA seqDB search
MHKLFVPYVMGNRDFIENVKTLSEAGADIVEVGVPFSDPVADGPVIMNVGNKAIQEGVNI
QYIFDQLTENQDEIQSKYVLMTYYNIINHYGELAFLNACEQAGVYGLIIPDLPHELVQQL
KARHPERKTNIISLIAMTTSNTRSHQIAKDAEGFIYTVTMNATTGEDGKFHPELKNRIKD
IKAHTEVPVVAGFGIRTAAHVKDIIEASDGVVIGSEIVKRFENDDKQTTIEYLKTIRNVL
N
NT seq 726 nt NT seq  +upstreamnt  +downstreamnt
atgcataaattatttgtaccttatgttatgggcaacagagactttattgaaaatgtaaaa
acactaagtgaagcaggtgcagatatagttgaagtgggtgttccattttcagaccctgtt
gctgatgggccggtaatcatgaatgttggtaataaagcaattcaagaaggcgttaatata
caatatattttcgatcaacttacagaaaatcaagatgagattcaaagtaagtatgtgtta
atgacatactacaatatcattaatcattatggtgaattagcatttttgaatgcttgtgaa
caagcaggtgtgtatggtttgatcataccagatttgcctcatgagttggtgcaacaactt
aaagcgcgtcatccagaacgcaaaacaaatattatttcattaattgctatgacaacttca
aatactagaagtcatcaaatagccaaggatgcagaaggatttatttatactgtaacgatg
aatgcgactacaggcgaagatggtaaatttcatccagagctaaaaaatagaattaaagat
ataaaagcacatactgaagttcctgtagtagctggatttggtataagaacagcagcacat
gtaaaagatattattgaagcttcagatggcgtagtgataggtagtgaaatagtaaaacgc
tttgaaaatgacgataaacaaactaccattgagtatttaaaaacaataagaaatgtcttg
aattaa

DBGET integrated database retrieval system