KEGG   Staphylococcus saprophyticus: SSP1374Help
Entry
SSP1374           CDS       T00269                                 

Definition
(GenBank) tryptophan synthase beta chain
  KO
K01696  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
ssp  Staphylococcus saprophyticus
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:ssp00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    SSP1374
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    SSP1374
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    SSP1374
Enzymes [BR:ssp01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     SSP1374
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(1419243..1420457)
Genome map
AA seq 404 aa AA seqDB search
MVENIQTEADAFGFFGNYGGQYVPETLMPAIQELKQAYQDAKNDPQFQIELDDYLKDYVG
RETPLTYAKSYSELLGGAKIYLKREDLNHTGAHKINNALGQALLAKRMGKNKLVAETGAG
QHGVASATVAALFDMELVVFMGEEDIKRQSLNVFRMELLGAKVESVTEGQGTLSDAVNKA
LQYWVSHVDDTHYLLGSALGPDPFPTIVRDFQKIIGQEIKAQVHEKEGQLPDAIVACVGG
GSNAIGTFYPFVKDDVKLYGVEAAGDGIDSDKHALAINKGKEGVLHGTKMYLIQDDDGQI
QLAHSISAGLDYPGVGPEHSYYHDIGRVKYATASDKQAMDALVRFTKAEGIIPAIESAHA
LSYVETLAPTMRNDEILVVTVSGRGDKDMETIRNYMKQEGDTHA
NT seq 1215 nt NT seq  +upstreamnt  +downstreamnt
atggttgaaaatatacaaacagaagcagatgcatttggttttttcggtaattatggtgga
caatatgtaccagaaacattaatgcccgcaatacaagaattgaaacaagcttatcaggac
gctaaaaatgatcctcaatttcagatagaacttgatgattacttaaaagattacgtaggt
cgtgaaacaccgctaacatatgctaagtcttattcggaattacttggtggtgcaaaaatc
tatttgaaacgtgaggatttaaaccatacgggtgcacataaaattaataatgcacttggt
caagcactgttagctaaacgcatgggaaaaaataaattagtagccgaaactggagcgggg
caacatggtgttgctagtgcaactgtagctgccttatttgatatggaactcgttgtgttt
atgggtgaagaagatatcaaaagacaatcattaaacgtgtttagaatggaactattaggc
gcaaaagtggaatcagtcactgaaggacaaggcacattatctgatgcagtcaataaagca
ttacagtactgggtaagccatgttgatgatacgcattatttgctaggctctgcactggga
cctgatccttttcctactattgtaagagactttcaaaaaattattggtcaagaaattaaa
gcacaagttcatgaaaaagaaggtcaattaccagatgctattgtcgcatgtgtaggcggt
ggttctaatgccatcgggacgttttatccatttgtaaaggatgatgttaagctttacggt
gttgaggcagcgggcgacggaatagattcagataaacacgcgcttgctataaataaaggt
aaagaaggcgtgttacatggtactaaaatgtatttaattcaagatgatgatggtcaaata
caattagcacactcaatatctgcaggattggattatcctggcgttggtccagagcattca
tattatcatgacattggaagagtgaaatatgctactgcaagtgacaaacaagcaatggat
gctttagtgcgatttactaaagcggaaggtatcataccagctatcgaaagtgcacatgcc
ttaagttatgtagaaacattggcacctacgatgcgtaacgatgaaatacttgtggttaca
gtatcaggccgcggtgataaagatatggaaacgattagaaattatatgaaacaggagggt
gacacgcatgcataa

DBGET integrated database retrieval system