KEGG   Staphylococcus saprophyticus: SSP1387Help
Entry
SSP1387           CDS       T00269                                 

Definition
(GenBank) prephenate dehydrogenase
  KO
K04517  
prephenate dehydrogenase [EC:1.3.1.12]
Organism
ssp  Staphylococcus saprophyticus
Pathway
Phenylalanine, tyrosine and tryptophan biosynthesis
Novobiocin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:ssp00001]
 Metabolism
  Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    SSP1387
  Biosynthesis of other secondary metabolites
   00401 Novobiocin biosynthesis
    SSP1387
Enzymes [BR:ssp01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.12  prephenate dehydrogenase
     SSP1387
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
1430243..1431334
Genome map
AA seq 363 aa AA seqDB search
MKQILFVGLGLIGGSLASNLRYYHDDIEITAFDADTSQLDKALSIGIIDYQSTDYKTSVE
NADIIIYATPVQQTVKYLQDLPNYQLKKHVIITDTGSTKSTIQQYEQFLLNHDIHLVGGH
PMAGSHKSGVLNAKKHLFENAFYILVHNETDNDAAFEEIQHLLQTTSAKFISTTAEEHDF
VTGIVSHVPHIIASSLVHLNAQHVEDSSLVKTLAAGGFRDITRIASSNPIMWRDITIENK
NTILRILKEWKNQMSDVINIIEHNNPDELYDFFNDAKVYRDQLPLKQQGALSVEYDLYVD
IPDKPGMISKVTNILSLHNISISNLRILEVREDIYGALRVSFKNPQDRKDGADALSDFDT
YFD
NT seq 1092 nt NT seq  +upstreamnt  +downstreamnt
atgaaacaaattcttttcgttggcttaggccttattggcggaagcttagcgagtaactta
agatattatcatgatgatatcgaaataaccgcctttgatgcggatacttcacaattagat
aaagcattgtctattggtatcatagattatcaatcaactgactataaaactagtgttgaa
aatgctgacattattatttatgcaacaccggtacagcagactgttaaatacttacaagat
ttaccaaactatcaactaaaaaaacatgtaattattacagatactggaagtacaaagtca
acgattcaacaatatgagcagtttcttttaaatcatgatattcatttggttggcggccat
cctatggcaggaagccataaatctggagtattaaatgcaaaaaaacatttatttgaaaat
gctttttatattttagttcataatgaaactgataatgatgctgcttttgaggaaatacag
cacttattacaaacaacgagtgctaaatttatttctacaacagcggaagaacatgatttt
gtcactggtattgtgagtcacgtccctcatatcattgcttcaagtctcgttcatttgaat
gcgcaacatgtcgaagattcttcacttgttaagacgcttgcagctggtggttttagagat
attactagaatcgcaagtagtaatcctattatgtggcgtgatattactattgaaaataaa
aatacaatattgcgcattttaaaagaatggaaaaatcaaatgtctgatgtcattaatata
atcgaacacaataatcctgatgaactttatgattttttcaacgatgctaaagtttatcgt
gatcagttaccccttaaacaacaaggtgcactatctgtggagtatgatctatatgtagac
attccggataaaccgggtatgataagcaaagttacaaacatcctaagtttacataatatt
tctataagcaacttgagaatattagaagttcgtgaagatatttatggtgcacttcgagtt
agttttaaaaacccacaagatcgcaaagatggtgcagatgcgcttagtgattttgatact
tattttgattaa

DBGET integrated database retrieval system