KEGG   Staphylococcus saprophyticus: SSP1391Help
Entry
SSP1391           CDS       T00269                                 

Definition
methionine sulfoxide reductase A (EC:1.8.4.11)
Orthology
K07304  
peptide-methionine (S)-S-oxide reductase [EC:1.8.4.11]
Organism
ssp  Staphylococcus saprophyticus
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1434344..1434859
Genome map
AA seq 171 aa AA seqDB search
MNINKAYFAGGCFWCMVKPFDTFEGIESVTSGYMGGHVDNPSYEQVKTGNTGHLETVEIE
YDVALFSYNKLLEIFFSVIDPSDEGGQFQDRGAQYKTAIFYTNEDQKNVAEEYIEQLKET
IDKDKAIATQVLPAATFYEAEPEHQDFYKKNPERYAKEQQDRQNYKQQTDK
NT seq 516 nt NT seq  +upstreamnt  +downstreamnt
atgaatataaacaaagcctacttcgcaggaggttgcttttggtgtatggttaaacccttc
gacacatttgaaggtattgaaagcgtaacctctggctatatgggaggacatgtggataat
ccttcatatgagcaagttaagacaggcaacactggacatttggaaactgttgaaatcgaa
tatgatgtagcactgttttcatacaataaattattagaaattttcttttcagtaatagac
ccatcagatgaaggcggacaatttcaagatagaggtgcacagtacaaaactgctatcttc
tataccaatgaagaccaaaaaaatgttgccgaagaatatattgaacaactcaaagaaaca
atcgataaagataaagctattgcaacacaagtattacctgctgctacattttatgaagca
gagccagaacatcaagatttttataaaaaaaatccagaacgttacgccaaagaacaacaa
gaccgtcaaaattataagcaacagacagataaataa

DBGET integrated database retrieval system